DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33453

DIOPT Version :8

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster

Alignment Length:184 Identity:40/185 (22%)
Similarity:64/185 (35%) Gaps:50/185 (27%)


  Fly     1 MMTDAFLRGLLILCCLVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDI--VEMPKKQG 63
            |.::..|.|:.:....::      |..:...:|:..::.|..|:.:.|....|.:  ....|...
  Fly     1 MNSNVILPGVFLAALFLI------SSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSL 59

  Fly    64 NFLNTFLLLRRSVT---KMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRI------- 118
            |...|||....:|:   ||...|| |.      :|.  ||.:.:|.|..:..|....|       
  Fly    60 NINATFLHPTNNVSLRLKMVKRLS-GY------KPF--LFDVTIDACQFLRKRHNPVIKMFYSFI 115

  Fly   119 -----LN---------------AVLHKLLQSGNYPDACPLLANVNYTSTRFALN 152
                 ||               ||....|.||:|.   .||..:.|...:|.:|
  Fly   116 KDYSTLNHTCPYGLQVVSDYHTAVFPVPLPSGDYG---VLLDFIFYAKKQFHVN 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/86 (23%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C300559
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.