DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33463

DIOPT Version :8

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_995846.1 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:157 Species:Drosophila melanogaster

Alignment Length:105 Identity:23/105 - (21%)
Similarity:42/105 - (40%) Gaps:3/105 - (2%)


  Fly    33 IRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQ 97
            :.:::|||..:|...:|...|.:..:.:..........||:..||...|.   |.:..|.:....
  Fly     2 LEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVN---GALFQRHNGYKP 63

  Fly    98 QLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACP 137
            .|:.|.||.|.|::....|.:.:.......:..|...:||
  Fly    64 FLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCP 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 10/43 (23%)
CG33463NP_995846.1 DUF1091 50..135 CDD:284008 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301012
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.