DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13250 and CG33483

DIOPT Version :9

Sequence 1:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:226 Identity:47/226 - (20%)
Similarity:80/226 - (35%) Gaps:66/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVVPILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMW 80
            |::.|....:::|.||:  :.:|.|:.:|....:...|.:..:.:..........:.:..|||:.
  Fly     8 LIIVIFHSVNMSTSDFE--FTNIKCTSLDKDFDDFEYCHLKSVNRTFKYISVKVRMYKIPVTKVK 70

  Fly    81 VELSVGQIANRKDRPVQQLFKIRVDGCHL--IEFRSKSRILNAVLHK-----------LLQ--SG 130
            : .|:.:..|.|.....:.|. ..:.|||  :....|...|...|||           ||:  :|
  Fly    71 I-ASLVEFTNIKCTSWDKAFD-DFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNG 133

  Fly   131 NYP-------DACPLL-------------------ANVNYTSTRFALNP-DH------FPAYMPD 162
            ..|       |||..|                   :|:|:|.      | ||      .|....:
  Fly   134 YKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTC------PFDHDLIVEKLPTNFMN 192

  Fly   163 MKFNTKLVFQLSRNM--------GLIRASVD 185
            .|.|..:.|.....:        |:.||:||
  Fly   193 QKVNGDIKFPHGDYLFHSDWYAYGINRATVD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13250NP_649245.1 DM8 95..181 CDD:214778 28/141 (20%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.