DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and NBP35

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_568748.1 Gene:NBP35 AraportID:AT5G50960 Length:350 Species:Arabidopsis thaliana

Alignment Length:290 Identity:132/291 (45%)
Similarity:181/291 (62%) Gaps:39/291 (13%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDD 66
            :..||:.|:||||||||||||.|.|||.||.....:|||:|||:||||:|.:|||||::|.|.:.
plant    55 MSTVKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQEIHQSNL 119

  Fly    67 GWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSD 131
            ||.|||.:::  |.||||||:|.|.::.||||||:|..:|:|||.||.|.|:|||::|.||||||
plant   120 GWSPVYVEDN--LGVMSIGFMLPNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSD 182

  Fly   132 EHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCP------- 189
            |||::::.|...|..|||||||||||:|.|||||::||||.|:.:||:||||||...|       
plant   183 EHISIVQYLLPTGIDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENMSGLSQPLKDVKFM 247

  Fly   190 ----------------------------HCTSCTNIFSSNGGVS--LATYAQVPHLGTLPIDPRV 224
                                        ...:|:.:|.|:||.:  :.....||.||.:|:||::
plant   248 KLATETGSSINVTEDVIACLRKNAPELLDIVACSEVFDSSGGGAERMCREMGVPFLGKVPMDPQL 312

  Fly   225 GILAGTTTSVLDELPDSTTAEVLTHIVEKL 254
            ...|....|..::.....:|..|..|::|:
plant   313 CKAAEQGKSCFEDNKCLISAPALKSIIQKV 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 132/287 (46%)
minD_arch 8..254 CDD:131024 130/283 (46%)
NBP35NP_568748.1 ParA 58..343 CDD:287566 132/288 (46%)
minD_arch 62..343 CDD:131024 130/284 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 O PTHR23264
Phylome 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.