DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and INDH

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_193689.1 Gene:INDH AraportID:AT4G19540 Length:313 Species:Arabidopsis thaliana

Alignment Length:265 Identity:96/266 (36%)
Similarity:148/266 (56%) Gaps:20/266 (8%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLAL-RKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCD 65
            |..||::|.|.|||||||||:.:..|::|| .|...|:||||.|:.|||||.::.:..:.....|
plant    39 LHGVKDIIAVASGKGGVGKSSTAVNLAVALANKCELKIGLLDADVYGPSVPIMMNINQKPQVNQD 103

  Fly    66 DGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTS 130
            ...:||   |:..:..||:| ||..::.|::||||.....:.:....|.|.:||.|::|.||||.
plant   104 MKMIPV---ENYGVKCMSMG-LLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDILVVDMPPGTG 164

  Fly   131 DEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCT 195
            |..|::.:.||   ..||:||:|||:|||.|..:.|:...|..:.|||:|||||.||||||...:
plant   165 DAQISISQNLK---LSGAVIVSTPQDVALADANRGISMFDKVRVPILGLVENMSCFVCPHCNEPS 226

  Fly   196 NIFSSNGGVSLATYAQVPHLGTLPI--------DPRVGILAGTTTSVLDELPDSTTAEVLTHIVE 252
            .||...|....|....:..:|.:|:        |..|.::..:..|::.:    ...::..::|:
plant   227 FIFGKEGARRTAAKKGLKLIGEIPLEMSIREGSDEGVPVVVSSPGSIVSK----AYQDLAQNVVK 287

  Fly   253 KLKTM 257
            .||.:
plant   288 GLKEL 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 93/259 (36%)
minD_arch 8..254 CDD:131024 91/255 (36%)
INDHNP_193689.1 ParA 41..286 CDD:287566 92/256 (36%)
FlhG 45..287 CDD:223531 91/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.