DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and HCF101

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_189086.1 Gene:HCF101 AraportID:AT3G24430 Length:532 Species:Arabidopsis thaliana

Alignment Length:247 Identity:88/248 (35%)
Similarity:123/248 (50%) Gaps:23/248 (9%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDD 66
            |.::.|:|.|.|.|||||||||:..|:..|...|.:||:.|.|:.|||:|.::..|.| |.:.:.
plant   172 LSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPESR-ILEMNP 235

  Fly    67 GWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSD 131
            ....:...|...:.::|.||..:.|   .|.|||..:.:|.|.||...|.|||||:||.||||.|
plant   236 EKKTIIPTEYMGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD 297

  Fly   132 EHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGF------VCPH 190
            ..:|:.:.   .....|:||||||::|..||.|.:....|..:..:.:||||..|      ..| 
plant   298 IQLTLCQV---APLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYP- 358

  Fly   191 CTSCTNIFSSNGGVSLATYAQVPHLGTLPIDPRVGIL--AGTTTSVLDELPD 240
                   |....|..:.....:|||..|||.|.:...  :||...|.|.|.|
plant   359 -------FGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSD 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 87/246 (35%)
minD_arch 8..254 CDD:131024 86/242 (36%)
HCF101NP_189086.1 DUF59 76..160 CDD:294611
Mrp 120..383 CDD:223563 81/226 (36%)
ParA 174..411 CDD:287566 87/246 (35%)
DUF971 430..515 CDD:283749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.