DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and Nubpl

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_084036.2 Gene:Nubpl MGIID:1924076 Length:319 Species:Mus musculus

Alignment Length:261 Identity:98/262 (37%)
Similarity:147/262 (56%) Gaps:13/262 (5%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK--VGLLDIDLCGPSVPYLLGLEGRDIFQC 64
            ::.|:.||||.||||||||||.:..|:|||..|...  |||||:|:.|||:|.::.|.|......
Mouse    63 IEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMMNLRGNPELSP 127

  Fly    65 DDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ::...|:.   :..:|.||:|||::... |::|||......|.:.|..|.|.:||||::|.||||
Mouse   128 NNLMRPLL---NYGIACMSMGFLVEETA-PLVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGT 188

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            .|..::|.:   .:...||:||:|||::||.|..|.....:|..:.:||:|:|||.|.||.|...
Mouse   189 GDVQLSVSQ---NIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQCPKCKHK 250

  Fly   195 TNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHI----VEKLK 255
            |:||.::|...||....:..||.:|:...:...:.....|:...|.|..|:...||    |.:||
Mouse   251 THIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPGSDEAKAYLHIASEVVRRLK 315

  Fly   256 T 256
            :
Mouse   316 S 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 96/256 (38%)
minD_arch 8..254 CDD:131024 95/252 (38%)
NubplNP_084036.2 Mrp 17..284 CDD:223563 89/228 (39%)
ParA 65..311 CDD:287566 95/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.