DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubp2

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001032191.2 Gene:nubp2 ZFINID:ZDB-GENE-051023-10 Length:269 Species:Danio rerio

Alignment Length:259 Identity:144/260 (55%)
Similarity:189/260 (73%) Gaps:2/260 (1%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDD 66
            ||:||:|::||||||||||||::|:|:||.|..|.|||:||:||||||:|.:|.:...::.|||.
Zfish     9 LDQVKHVLLVLSGKGGVGKSTITTELALAFRHAGKKVGILDVDLCGPSIPRMLSVGKPEVHQCDS 73

  Fly    67 GWVPVYTD--ESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ||||||.|  :.|.||:|||.|||::.::.|||||||||.:|.||::||.|.|||.|::||||||
Zfish    74 GWVPVYADPQQQQQLALMSIAFLLEDSDEAVIWRGPKKTALIGQFVSDVAWGELDILLVDTPPGT 138

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            ||||:.|:|.|::....||::|||||.|:..|||:||||||||.:.||||||||||||||||:.|
Zfish   139 SDEHLAVLENLRKHRVDGAVLVTTPQAVSTGDVRREITFCKKTNLKILGIVENMSGFVCPHCSEC 203

  Fly   195 TNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTML 258
            :||||..||..||.......||::|:||.:..........|...|:|:|...::||...|...|
Zfish   204 SNIFSKGGGEELAKLTGSAFLGSVPLDPLLTESLEEGRDFLQAFPESSTFTAISHIANTLLNSL 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 140/252 (56%)
minD_arch 8..254 CDD:131024 138/248 (56%)
nubp2NP_001032191.2 ParA 11..264 CDD:287566 141/253 (56%)
minD_arch 15..263 CDD:131024 138/248 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40402505
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H8057
Inparanoid 1 1.050 300 1.000 Inparanoid score I2627
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1053850
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R189
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.