DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubpl

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012823878.1 Gene:nubpl XenbaseID:XB-GENE-971259 Length:347 Species:Xenopus tropicalis

Alignment Length:218 Identity:86/219 (39%)
Similarity:127/219 (58%) Gaps:9/219 (4%)


  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLSLALRKNG--FKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDG 67
            ||:|:||.||||||||||.:..|:|.:..:.  ..|||||.|:.|||:|.::.|:|.......:.
 Frog    66 VKHVVVVASGKGGVGKSTTAVNLALGIAASDQVKAVGLLDADVYGPSIPRMMNLKGNPEVSNKNL 130

  Fly    68 WVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDE 132
            .:|::   :..:..||:|||::... |::|||......|.:.|..|.|.|||||:||.||||.|.
 Frog   131 MIPLF---NYGIRCMSMGFLVEETA-PIVWRGLMVMSAIEKLLRQVEWGELDYLVIDMPPGTGDV 191

  Fly   133 HITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNI 197
            .:::.:   .:...||:||:|||::||.|.|:.....:|..:.:||.|:|||.|.||.|...|:|
 Frog   192 QLSISQ---NIPISGAVIVSTPQDIALVDARRGAEMFQKVNVPVLGFVQNMSIFQCPKCNHETHI 253

  Fly   198 FSSNGGVSLATYAQVPHLGTLPI 220
            |...|...||.......||.:|:
 Frog   254 FGEEGARRLAESLGFDILGDIPL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 86/219 (39%)
minD_arch 8..254 CDD:131024 84/216 (39%)
nubplXP_012823878.1 Mrp 15..284 CDD:223563 86/219 (39%)
ParA 65..339 CDD:287566 86/219 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.