DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubp1

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001015835.1 Gene:nubp1 XenbaseID:XB-GENE-992726 Length:320 Species:Xenopus tropicalis

Alignment Length:257 Identity:134/258 (52%)
Similarity:178/258 (69%) Gaps:5/258 (2%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK-VGLLDIDLCGPSVPYLLGLEGRDIFQCD 65
            |..||:.|:||||||||||||.|..|:..|.::..| |.|||:|:||||:|.::||||..:.|..
 Frog    54 LSSVKHKILVLSGKGGVGKSTFSAHLAHGLAQDESKEVALLDVDICGPSIPKMMGLEGEQVHQSG 118

  Fly    66 DGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTS 130
            .||.|||.:::  |||||:||||.:.:|.||||||||..||:|||.||.|.|:||||||||||||
 Frog   119 SGWSPVYVEDN--LAVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIIDTPPGTS 181

  Fly   131 DEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCT 195
            |||::|::.|...|..||:|:||||||:|.||||||.||.|..:.|:|:|||||||:||.|.:.:
 Frog   182 DEHLSVVQYLSVAGIDGAVIITTPQEVSLQDVRKEINFCHKVKLPIIGVVENMSGFICPKCKNES 246

  Fly   196 NIF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLK 255
            .||  ::.|...:.|...|..||.:|:||.:|....|..|...|:|||........|:::::
 Frog   247 QIFPPTTGGAEKMCTDLNVSLLGKVPLDPNIGKSCDTGKSFFSEIPDSPATLSYRTIIQRIQ 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 133/253 (53%)
minD_arch 8..254 CDD:131024 131/249 (53%)
nubp1NP_001015835.1 ParA 57..307 CDD:313763 133/252 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.