DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubp1

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001017538.1 Gene:nubp1 ZFINID:ZDB-GENE-050417-471 Length:321 Species:Danio rerio

Alignment Length:262 Identity:140/263 (53%)
Similarity:182/263 (69%) Gaps:5/263 (2%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK-VGLLDIDLCGPSVPYLLGLEGRDIFQCD 65
            :..||:.|:||||||||||||.|..||.||..:..| |.|||:|:||||:|.::||||..:.|..
Zfish    54 MTSVKHKILVLSGKGGVGKSTFSAHLSHALASDSSKEVALLDVDICGPSIPKIMGLEGEQVHQSG 118

  Fly    66 DGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTS 130
            .||.|||.:::  ||||||||||.:.:|.||||||||..||:|||.||.|.|:||||:|||||||
Zfish   119 SGWSPVYVEDN--LAVMSIGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTS 181

  Fly   131 DEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCT 195
            |||:::::.|...|..||:|:||||||:|.||||||.||||..:.|||::|||||||||.|.:.:
Zfish   182 DEHLSIVQYLSGAGIDGAVIITTPQEVSLQDVRKEIRFCKKVNLPILGVIENMSGFVCPKCKNTS 246

  Fly   196 NIF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTML 258
            .||  ::.|...:.....:|.||.:|:|||:|.......|.|.|:|||..|.....||:|::...
Zfish   247 QIFPPTTGGAQRMCEELNLPLLGRIPLDPRIGKSCDEGKSFLTEVPDSPAAAAYQSIVQKIRDYC 311

  Fly   259 VS 260
            .|
Zfish   312 AS 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 139/253 (55%)
minD_arch 8..254 CDD:131024 137/249 (55%)
nubp1NP_001017538.1 ParA 56..307 CDD:287566 139/253 (55%)
FlhG 59..317 CDD:223531 138/258 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.