DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and CG17904

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster

Alignment Length:262 Identity:123/263 (47%)
Similarity:168/263 (64%) Gaps:21/263 (8%)


  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLS--LALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDG 67
            ||:.:::||||||||||||::.|:  ||........|:||||:||||.|.|:|..|..:.|...|
  Fly    54 VKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYG 118

  Fly    68 WVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDE 132
            |.||..:::  :.:|||||||.:.:|.:|||||||..||||||::|.|..||.|::|||||||||
  Fly   119 WSPVGIEDN--VCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDE 181

  Fly   133 HITVMECLKEVG---CHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            |::|:..||:..   ...|::|||||||:|.||||||.||||..|.|:|::||||.|.|.||.:.
  Fly   182 HLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNS 246

  Fly   195 TNIFSSNGGVSLATYAQ--VPHLGTLPIDPRVGILAGTTTSVLDELPDST-----TAEVLTHIVE 252
            :.||.:..|.:.|..|:  :|.||:||:|.::       :...|...|.|     |.|.|..|..
  Fly   247 SEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQI-------SKACDSGEDLTEFKNVTTEALEGICS 304

  Fly   253 KL 254
            |:
  Fly   305 KI 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 123/261 (47%)
minD_arch 8..254 CDD:131024 121/258 (47%)
CG17904NP_609805.1 Mrp 10..282 CDD:223563 115/237 (49%)
ParA 54..307 CDD:287566 123/263 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40407121
eggNOG 1 0.900 E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 P PTHR23264
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.