DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4858 and Nubpl

DIOPT Version :9

Sequence 1:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001171954.1 Gene:Nubpl / 299008 RGDID:1307232 Length:319 Species:Rattus norvegicus


Alignment Length:261 Identity:96/261 - (36%)
Similarity:150/261 - (57%) Gaps:13/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK--VGLLDIDLCGPSVPYLLGLEGRDIFQC 64
            ::.|:.||||.||||||||||.:..|:|||..|...  |||||:|:.|||:|.::.|:|......
  Rat    63 IEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMMNLKGNPELSP 127

  Fly    65 DDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ::...|:.   :..:|.||:|||::... |::|||......|.:.|..|.|.:||||::|.||||
  Rat   128 NNLMRPLL---NYGIACMSMGFLVEETA-PLVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGT 188

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            .|..::|.:   .:...||:||:|||::||.|..|.....:|..:.:||:|:|||.|.||.|...
  Rat   189 GDVQLSVSQ---NIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQCPQCKHK 250

  Fly   195 TNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAE----VLTHIVEKLK 255
            |:||.::|...||....:..||.:|:...:...:.....|:...|:|..|:    :.:.:|.:||
  Rat   251 THIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPESDEAKAYLNIASEVVRRLK 315

  Fly   256 T 256
            :
  Rat   316 S 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 94/255 (37%)
minD_arch 8..254 CDD:131024 93/251 (37%)
NubplNP_001171954.1 Mrp 13..284 CDD:223563 89/227 (39%)
ParA 65..311 CDD:287566 93/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.