DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and Nubp2

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006524369.3 Gene:Nubp2 MGIID:1347072 Length:303 Species:Mus musculus

Alignment Length:250 Identity:136/250 (54%)
Similarity:193/250 (77%) Gaps:0/250 (0%)


  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWV 69
            |:::|:||||||||||||:||:|:||||..|.|||:||:||||||:|::|..:|:.:.|||:|||
Mouse    45 VRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQCDNGWV 109

  Fly    70 PVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHI 134
            ||:.|:.|::::||:||||:|.::.|:||||||..:|:||::||.|.:||||::||||||||||:
Mouse   110 PVFVDQEQSISLMSVGFLLENPDEAVVWRGPKKHALIKQFVSDVAWGQLDYLVVDTPPGTSDEHM 174

  Fly   135 TVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFS 199
            ..||.|:.....||::|||||.|::.|||:|:|||||||:.::|::||||||.||||..|||:||
Mouse   175 ATMEALRPYRPLGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFS 239

  Fly   200 SNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKL 254
            |..|..||..|.||.||::|:|.::..........:.|.|.||....||.|.:::
Mouse   240 SGSGEELARLAGVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTAYSALTSIAQRV 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 136/249 (55%)
minD_arch 8..254 CDD:131024 135/246 (55%)
Nubp2XP_006524369.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40402484
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H8057
Inparanoid 1 1.050 311 1.000 Inparanoid score I2558
Isobase 1 0.950 0 Normalized mean entropy S504
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1084673
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R189
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.