DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and Nubp1

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036085.1 Gene:Nubp1 MGIID:1347073 Length:320 Species:Mus musculus

Alignment Length:259 Identity:130/260 (50%)
Similarity:178/260 (68%) Gaps:8/260 (3%)


  Fly     3 DKVKNV---IVVLSGKGGVGKSTVSTQLSLALRKNG-FKVGLLDIDLCGPSVPYLLGLEGRDIFQ 63
            :|:|.|   ::||||||||||||.|..|:..|.::| .:|.|||||:||||:|.::||||..:.|
Mouse    48 EKMKTVRHKLLVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQ 112

  Fly    64 CDDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPG 128
            ...||.|||.|::  |.|||:||||.:.:|.||||||||..||:|||.||.|.::||||:|||||
Mouse   113 SGSGWSPVYVDDN--LGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLIVDTPPG 175

  Fly   129 TSDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTS 193
            |||||::|::.|......||:|:||||||||.||||||:||.|..:.|:|:|||||||:||.|..
Mouse   176 TSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKCKK 240

  Fly   194 CTNIF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLK 255
            .:.||  ::.|..::....::|.||.:|:||.:|.......|...|.|||........|:::::
Mouse   241 ESQIFPPTTGGAEAMCQDLRIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYRSIIQRIR 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 130/256 (51%)
minD_arch 8..254 CDD:131024 128/252 (51%)
Nubp1NP_036085.1 BcsQ 49..309 CDD:224113 130/259 (50%)
ParA 53..303 CDD:287566 128/252 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.