DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and SPAC637.08

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_594626.1 Gene:SPAC637.08 PomBaseID:SPAC637.08 Length:317 Species:Schizosaccharomyces pombe

Alignment Length:261 Identity:134/262 (51%)
Similarity:185/262 (71%) Gaps:7/262 (3%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLS--LALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQC 64
            |.::|:.|:||||||||||||.|:||:  |:|.::. ::||:|:|:||||:|.::|:|..:..|.
pombe    56 LKEIKHKILVLSGKGGVGKSTFSSQLAWGLSLEEDK-QIGLMDVDICGPSIPRIMGVEKEEAHQS 119

  Fly    65 DDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ..||.|:|.  ...||||||||||.:.:..||||||||..:|:||:.||.|:.|||||:||||||
pombe   120 SKGWSPIYV--CPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDYLIVDTPPGT 182

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            ||||:::::..|..|..||::|||||||||.||||||.||:|..|.|||:||||||||||.|...
pombe   183 SDEHLSLVQFFKNSGIDGAVVVTTPQEVALQDVRKEIDFCRKASIPILGLVENMSGFVCPSCKGK 247

  Fly   195 TNIF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTM 257
            :|||  ::.||.:||....:|.||.:|:||.:........|.:||.|:|..:|::..|:.|:...
pombe   248 SNIFTITTGGGEALAKEMGLPFLGKIPLDPLIARSCDFGKSFIDECPESPASEIIIDIINKIDES 312

  Fly   258 L 258
            |
pombe   313 L 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 132/254 (52%)
minD_arch 8..254 CDD:131024 131/250 (52%)
SPAC637.08NP_594626.1 Mrp 16..283 CDD:223563 125/230 (54%)
ParA 59..300 CDD:287566 129/244 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.