DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4858 and SPAC637.08

DIOPT Version :9

Sequence 1:NP_649243.1 Gene:CG4858 / 40282 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_594626.1 Gene:SPAC637.08 / 2543416 PomBaseID:SPAC637.08 Length:317 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:134/261 - (51%)
Similarity:185/261 - (70%) Gaps:7/261 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLS--LALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQC 64
            |.::|:.|:||||||||||||.|:||:  |:|.::. ::||:|:|:||||:|.::|:|..:..|.
pombe    56 LKEIKHKILVLSGKGGVGKSTFSSQLAWGLSLEEDK-QIGLMDVDICGPSIPRIMGVEKEEAHQS 119

  Fly    65 DDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGT 129
            ..||.|:|.  ...||||||||||.:.:..||||||||..:|:||:.||.|:.|||||:||||||
pombe   120 SKGWSPIYV--CPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDYLIVDTPPGT 182

  Fly   130 SDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSC 194
            ||||:::::..|..|..||::|||||||||.||||||.||:|..|.|||:||||||||||.|...
pombe   183 SDEHLSLVQFFKNSGIDGAVVVTTPQEVALQDVRKEIDFCRKASIPILGLVENMSGFVCPSCKGK 247

  Fly   195 TNIF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTM 257
            :|||  ::.||.:||....:|.||.:|:||.:........|.:||.|:|..:|::..|:.|:...
pombe   248 SNIFTITTGGGEALAKEMGLPFLGKIPLDPLIARSCDFGKSFIDECPESPASEIIIDIINKIDES 312

  Fly   258 L 258
            |
pombe   313 L 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 131/253 (52%)
minD_arch 8..254 CDD:131024 130/249 (52%)
SPAC637.08NP_594626.1 Mrp 16..283 CDD:223563 125/229 (55%)
ParA 59..300 CDD:287566 129/243 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.