DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and SPAC806.02c

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_592852.1 Gene:SPAC806.02c PomBaseID:SPAC806.02c Length:608 Species:Schizosaccharomyces pombe

Alignment Length:266 Identity:144/267 (54%)
Similarity:187/267 (70%) Gaps:24/267 (9%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALR-----KNGFKVGLLDIDLCGPSVPYLLG--LEGR 59
            :|||::||:|||||||||||:|:|||:|:|.     ....|.|:|||||.|||:|.:.|  .|..
pombe     1 MDKVQHVILVLSGKGGVGKSSVTTQLALSLHDSKVYSRPLKTGILDIDLTGPSIPRMFGKDAERN 65

  Fly    60 DIFQCDDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIID 124
            .|.|...|||||||||::.:.:||:||||.::.|.|:||||||..|||||::||.|.|||:||||
pombe    66 RIHQSSAGWVPVYTDETKEIGLMSLGFLLTSKNDSVVWRGPKKAAMIRQFISDVSWGELDFLIID 130

  Fly   125 TPPGTSDEHITVMECL-------KEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVEN 182
            |||||.|||:|::|.|       ::|...||:||||||.:|..||:|||.||||..|.|||||||
pombe   131 TPPGTGDEHLTIVESLLSETSTVRDVPIDGAVIVTTPQGIATLDVQKEIDFCKKASIKILGIVEN 195

  Fly   183 MSGFVCPHCTSCTNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVL 247
            |||::||||..|||||||.||::|:...::|.||::||||:.|.:....|      |||.    :
pombe   196 MSGYICPHCADCTNIFSSGGGLTLSEKYKLPFLGSVPIDPKFGEMIENLT------PDSN----I 250

  Fly   248 THIVEK 253
            .|:..|
pombe   251 VHLYSK 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 143/265 (54%)
minD_arch 8..254 CDD:131024 141/261 (54%)
SPAC806.02cNP_592852.1 ParA 3..269 CDD:287566 143/265 (54%)
COG1149 8..246 CDD:224071 135/244 (55%)
WD40 <283..608 CDD:225201
WD40 283..606 CDD:238121
WD40 repeat 293..330 CDD:293791
WD40 repeat 337..376 CDD:293791
WD40 repeat 381..420 CDD:293791
WD40 repeat 427..464 CDD:293791
WD40 repeat 470..507 CDD:293791
WD40 repeat 534..575 CDD:293791
WD40 repeat 582..605 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8057
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1125518
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R189
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.