DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubp-1

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_492653.2 Gene:nubp-1 WormBaseID:WBGene00008664 Length:313 Species:Caenorhabditis elegans

Alignment Length:260 Identity:123/261 (47%)
Similarity:174/261 (67%) Gaps:6/261 (2%)


  Fly     4 KVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFK-VGLLDIDLCGPSVPYLLGLEGRDIFQCDDG 67
            ::|:.|::|||||||||||:::.|:.||..:..| |.:||:|:||||.|.::|:|..::....||
 Worm    56 RIKHKILILSGKGGVGKSTLTSNLARALASDPSKQVAILDVDICGPSQPRMMGVEDEEVHNSADG 120

  Fly    68 WVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDE 132
            |.||....:.||  |||.|||.::.|.|||||.:|..||:|||.||.|.|:|||:||||||||||
 Worm   121 WTPVGIQPNLTL--MSIAFLLGDKNDAVIWRGARKNGMIKQFLKDVDWGEVDYLLIDTPPGTSDE 183

  Fly   133 HITVMECLKEVG-CHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTN 196
            ||::::.|.:.| ..||:||:|||||:|.|||||::||.||.:.|||:||||:.||||:|...|.
 Worm   184 HISLVQFLLQAGPLDGALIVSTPQEVSLLDVRKEVSFCVKTKVPILGVVENMARFVCPNCAHTTL 248

  Fly   197 IF--SSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTMLV 259
            :|  |:.|...:...:.:..|..||::|.:...........:..||||.|:....:.||:|..||
 Worm   249 LFPTSTGGAEQMCKDSNLELLAQLPLEPALAKALDNGEDFFETNPDSTLAKSFLDLAEKVKAKLV 313

  Fly   260  259
             Worm   314  313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 120/254 (47%)
minD_arch 8..254 CDD:131024 119/250 (48%)
nubp-1NP_492653.2 Mrp 13..282 CDD:223563 113/228 (50%)
ParA 56..308 CDD:287566 120/254 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.