DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and NUBP2

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036357.1 Gene:NUBP2 HGNCID:8042 Length:271 Species:Homo sapiens

Alignment Length:250 Identity:138/250 (55%)
Similarity:189/250 (76%) Gaps:0/250 (0%)


  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWV 69
            |:::|:||||||||||||:||:|:||||..|.|||:||:||||||:|.:||.:||.:.|||.||.
Human    13 VRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWA 77

  Fly    70 PVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHI 134
            ||:.|..|::::||:||||:..::.|:||||||..:|:||::||.|.|||||::||||||||||:
Human    78 PVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDEHM 142

  Fly   135 TVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFS 199
            ..:|.|:.....||::|||||.|::.|||:|:|||:|||:.::|||||||||.|||||.||::||
Human   143 ATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFS 207

  Fly   200 SNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKL 254
            ..||..||..|.||.||::|:||.:..........:.|.|.|.....||.|.:|:
Human   208 RGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKI 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 138/249 (55%)
minD_arch 8..254 CDD:131024 137/246 (56%)
NUBP2NP_036357.1 ParA 13..262 CDD:313763 138/249 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40402696
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H8057
Inparanoid 1 1.050 308 1.000 Inparanoid score I2577
Isobase 1 0.950 0 Normalized mean entropy S504
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1074574
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R189
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.