DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4858 and nubp2

Sequence 1:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012825448.1 Gene:nubp2 XenbaseID:XB-GENE-999229 Length:270 Species:Xenopus tropicalis

Alignment Length:256 Identity:138/257 (54%)
Similarity:192/257 (75%) Gaps:0/257 (0%)


  Fly     2 LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDD 66
            |..|:::|:||||||||||||:||:::||||..|.|||:||:||||||:|.:|..:.:|:.|||.
 Frog    10 LSGVQHIILVLSGKGGVGKSTISTEIALALRHAGKKVGILDVDLCGPSIPRMLNAQSKDVHQCDS 74

  Fly    67 GWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSD 131
            ||||||.|:.:::::|||||||::.:|.|:||||||..:|:||.:||.|.:||:||:||||||||
 Frog    75 GWVPVYVDQEKSISLMSIGFLLEHPDDAVVWRGPKKNALIKQFASDVAWGDLDFLIVDTPPGTSD 139

  Fly   132 EHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTN 196
            |||..::.|:.....||::|||||.|::.|||:|:|||||||:.::||||||||:||||||.|||
 Frog   140 EHIATVDALRPFNPMGALLVTTPQAVSVGDVRRELTFCKKTGLRVIGIVENMSGYVCPHCTECTN 204

  Fly   197 IFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTM 257
            |||..||..||..:.||.||.:|:||.:..........:.|.|:|.....::.|..::..|
 Frog   205 IFSKGGGEELARLSGVPFLGCVPLDPLLSQSLEQGKDFVQEFPNSAAYPAISSIARQILDM 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4858NP_649243.1 ParA 4..254 CDD:287566 136/250 (54%)
minD_arch 8..254 CDD:131024 135/246 (55%)
nubp2XP_012825448.1 ParA 12..263 CDD:287566 136/251 (54%)
minD_arch 16..262 CDD:131024 135/246 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40401446
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H8057
Inparanoid 1 1.050 309 1.000 Inparanoid score I2442
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1060643
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R189
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.