DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and ATR1

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:82/364 - (22%)
Similarity:128/364 - (35%) Gaps:140/364 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LVLKEKK---------VILNENNDNKV------------EDTKVDDISPKEKKEN---------- 234
            :||.|.|         .:...:.||.:            ||..||.   .:|.:|          
Yeast     7 VVLTESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDS---NQKWQNPNYFKYAWQE 68

  Fly   235 ------------LNGEGKVNVEVNKPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGS--LN 285
                        ||..|         |:|.:.....|...|..|.|.::.|.....:.:||  |.
Yeast    69 YLFIFTCMISQLLNQAG---------TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 124

  Fly   286 SSDLWEV--LRKSRKDKNLLVIYLITFL-----SIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLG 343
            |..|.::  |:|.     |||.|::..:     .|..::|.|:    :...:..|:...::.:|.
Yeast   125 SGRLGDIYGLKKM-----LLVGYVLVIIWSLICGITKYSGSDT----FFIISRAFQGLGIAFVLP 180

  Fly   344 LLSVLAITSNILLG------YIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHH-----WMYWLSSI 397
              :||.|..||.:|      .:::.|||...|...|..||..::    ||..     |.::..||
Yeast   181 --NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLI----GTEDPKQWPWAFYAYSI 239

  Fly   398 LAALATIIPAANNAVASIYASP------------DNRGAVLGIISGIECLSEGVGPAFFGLLFFI 450
            .|.:        |.|.||||.|            |..|:|||:|..|             ||.|:
Yeast   240 AAFI--------NFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLI-------------LLNFV 283

  Fly   451 FQDDSETDLKVNSPIS--------MPFVISAISVFVAIV 481
            :.         .:|||        :..:||.|.:.|.|:
Yeast   284 WN---------QAPISGWNQAYIIVILIISVIFLVVFII 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 82/364 (23%)
MFS_1 30..441 CDD:284993 71/314 (23%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 70/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.