DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and QDR2

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_012145.1 Gene:QDR2 SGDID:S000001383 Length:542 Species:Saccharomyces cerevisiae

Alignment Length:531 Identity:96/532 (18%)
Similarity:171/532 (32%) Gaps:169/532 (32%)


  Fly    33 FMHYFSW--GLLTVPFIEKLSGSFGNRVLLVDGLVYGVRGILGFV----TTPVMGAISDFHGRKV 91
            |..:||.  |.:..|.:..:...|.     :|..:..|..::.||    ....||..:|..||:.
Yeast    69 FTGFFSTIAGAIYYPVLSVIERKFD-----IDEELVNVTVVVYFVFQGLAPTFMGGFADSLGRRP 128

  Fly    92 VMLLAV------------ATTYAPIPFM-MLKSWWFFAILTVSSICGSTYSSSLAYVADTTTVEN 143
            |:|:|:            |.|||.|..: .|::.....::.::|          ..:.|.||...
Yeast   129 VVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINS----------GIMGDVTTRAE 183

  Fly   144 RSKGYGFVAASFGAGIAFSPSLGNYLMKSYGSASVILIATITGMINILFIIFAVPESLVLKEKKV 208
            |....|:||.....|.||...:|..|...:|..::.....|...|..|.....:||:        
Yeast   184 RGGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILPET-------- 240

  Fly   209 ILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKELDQQFSKEENLQNDL 273
                                   |.|::|.|.|       |.::.:....:....:..::|..|.
Yeast   241 -----------------------KRNISGNGSV-------TPKSYLNRAPILVLPTVRKSLHLDN 275

  Fly   274 TEKEKID-NGSLNSSDLWEVLRKSRKDKNLLVIYLITFLSIWPFAGVDSTAPVYLKTNMGFEYEE 337
            .:.|.:: ...||....:::|    |...:.::.|:..|.   || :.:|....|.|.:..:|..
Yeast   276 PDYETLELPTQLNLLAPFKIL----KAYEICILMLVAGLQ---FA-MYTTHLTALSTALSKQYHL 332

  Fly   338 VSMMLGLL----SVLAITSNILLG------------YIMNIVGAK-------------------- 366
            ....:||.    .:..:.|.::.|            |..|.:|.|                    
Yeast   333 TVAKVGLCYLPSGICTLCSIVIAGRYLNWNYRRRLKYYQNWLGKKRSKLLEEHDNDLNLVQRIIE 397

  Fly   367 ---------WSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYAS---- 418
                     :..||....:.|.:...||..:.|...:.:.|||:..:     :..||::::    
Yeast   398 NDPKYTFNIFKARLQPAFVTLLLSSSGFCAYGWCITVKAPLAAVLCM-----SGFASLFSNCILT 457

  Fly   419 ----------PDNRGAVLGIISGIEC---------LSEGVGPAFFG---------------LLFF 449
                      |.......|.::...|         ||:.|....||               |||.
Yeast   458 FSTTLIVDLFPTKTSTATGCLNLFRCILSAVFIAALSKMVEKMKFGGVFTFLGALTSSSSILLFI 522

  Fly   450 IFQDDSETDLK 460
            :.:...|...|
Yeast   523 LLRKGKELAFK 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 96/532 (18%)
MFS_1 30..441 CDD:284993 89/496 (18%)
QDR2NP_012145.1 MFS 64..523 CDD:119392 94/520 (18%)
MFS_1 68..>369 CDD:284993 68/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107510886
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.