DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and GEX2

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_013032.1 Gene:GEX2 SGDID:S000001814 Length:615 Species:Saccharomyces cerevisiae

Alignment Length:266 Identity:54/267 (20%)
Similarity:82/267 (31%) Gaps:97/267 (36%)


  Fly    23 ASVWHAVIVTF--------------------MHYFSWGLLTVPFI-------------------- 47
            ||.|..:|:.:                    |..|.:.|.|:|.|                    
Yeast   188 ASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPIIFLILYMKYKSSKTAEWRSLK 252

  Fly    48 -----EKLSGSFGNRVLLVDGL-VYGVRGI---LGFVTTPVMGA---ISDFHGRKVVMLLA---- 96
                 |:..|.|.|.|.|...| :.|:..|   ||.:..|:..|   ...:|..|::..|.    
Yeast   253 EQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGC 317

  Fly    97 ---------VATTYAP-IPFMML--KSWW------FFAILTVSSICGSTYSSSLAYVADTTTVEN 143
                     .....:| :||.:|  :..|      ||...|....|...|...|..:.:::|...
Yeast   318 LFFIFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAA 382

  Fly   144 RSKGY-GFVAAS-------------------FGAGIAFSPSLGNYLMKSYGSAS---VILIATIT 185
            |.... .||||:                   .|...|:...:|.:.....||.|   ||..:.|.
Yeast   383 RIVNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIM 447

  Fly   186 GMINIL 191
            |:..:|
Yeast   448 GLSGLL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 52/265 (20%)
MFS_1 30..441 CDD:284993 51/260 (20%)
GEX2NP_013032.1 MFS 63..>235 CDD:119392 10/47 (21%)
MFS_1 94..490 CDD:284993 54/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107739696
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.