DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and YJL163C

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_012372.1 Gene:YJL163C SGDID:S000003699 Length:555 Species:Saccharomyces cerevisiae

Alignment Length:515 Identity:94/516 (18%)
Similarity:194/516 (38%) Gaps:130/516 (25%)


  Fly    11 VKVLVNRSGIGKASVWHAVIVTFMHYFSWGLLTVPFIEKLSGSFGNRVLLVDGLVYGVR--GILG 73
            |:.:|  |.|..:::..|..::......||        :||...|.  :.|...:.|:|  |:|.
Yeast   123 VQTIV--SSISSSTMMIAGAISIFMAGKWG--------ELSDRIGR--VRVFKYMSGIRVIGLLT 175

  Fly    74 FVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWFFAILTVSSICGSTYSSSLAYVADT 138
            .|.|  :.:...:|...:|:...:..::..:          ||::          ::..:||:|.
Yeast   176 HVFT--LSSKMKYHKWAIVLTACIVPSFGGL----------FALV----------ANGNSYVSDI 218

  Fly   139 TTVENRSKGYGFVAASFGAGIAFSPSLGNYLMK-SYGSASVILIATITGMINILFIIFAVPESLV 202
            ...|:|....|.:.:...|.:...|..|::|:| ::|:..:.:..:|.      |:|.|    |:
Yeast   219 VKTEHRMVTIGIMMSCIYATMGVGPMFGSFLVKWTHGNGFIPIYTSIA------FVILA----LI 273

  Fly   203 LKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKELDQQFSKEE 267
            :.| .:::...::.::..::......:||..:.:|                              
Yeast   274 ICE-TIMVEPRHETQMAHSQSTYTKRREKLRSQSG------------------------------ 307

  Fly   268 NLQNDLTEKEKIDNGSLNSSDLWEVLRKSRK------DKNLLV----IYLITFLSIWPFAGVDST 322
              .:|....:.:..|......|.::|...:|      ....||    :.|:..|.|....|..|.
Yeast   308 --SDDARNYQSVTYGKFQIMRLMDLLAPVKKLWLKPDSAGSLVPRHTVILLIVLDILFVCGTTSC 370

  Fly   323 APVYLKTNMGFEYEEVSMMLG-LLSVLAITSNILLGYI---------------------MNIVGA 365
            .|..:..:. :||:..::.|| .:|:|.|...::|..:                     ::|...
Yeast   371 MPALILFST-YEYKWHAVELGYFISILGIGRGVVLLVVSPTLLYTLKRIYQHLNHSIDKIDIFCI 434

  Fly   366 KWSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYASPDNRGAVLGIIS 430
            ::|:.:..|.||: |:.||..|...|...:.:.|..|...|...:.:.. |.|..:.|.:.|.::
Yeast   435 QFSMIVITLSLFV-MIRFGEKTPTSMIIFALLQALSAFCSPTLQSGIIK-YTSKKHTGEMFGAMA 497

  Fly   431 GI-ECLSEGVGPAFFGLLFFIFQDDSETDLKVNSPISM--PFVISAISVFVAIVLSSFIK 487
            .: .|:...:.|....|.        .:.:.||..:.|  ||..|    .|||:|:.|::
Yeast   498 LVRSCVMLVIPPILLKLY--------GSTVSVNPSLFMYIPFSTS----IVAILLTFFLR 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 90/500 (18%)
MFS_1 30..441 CDD:284993 76/447 (17%)
YJL163CNP_012372.1 MFS 149..545 CDD:119392 89/486 (18%)
MFS_1 149..508 CDD:284993 76/437 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5729
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.