DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and rtet

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_524429.1 Gene:rtet FlyBaseID:FBgn0028468 Length:477 Species:Drosophila melanogaster

Alignment Length:469 Identity:102/470 (22%)
Similarity:183/470 (39%) Gaps:115/470 (24%)


  Fly     9 PLVKVLVNRSGIGKASVWHAVIVTFMHYFSWGLLTVP--FIEKLSGSFGNRVLLVDGLVYGVRGI 71
            ||:..|:.......:|..:||:...:.:|. .||..|  :|..|.|          |.:..:...
  Fly    69 PLLPSLLEHYRQNDSSGLYAVLTDRVRWFQ-QLLGAPDRYISVLFG----------GFLGSMFSF 122

  Fly    72 LGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWFFAILTVSSICG----STYSSSL 132
            |.||.:|::|.:||::|||.| |||.|:..| :.:::......||:..::...|    ...|..:
  Fly   123 LQFVASPIVGGLSDYYGRKPV-LLACASGIA-LSYLIWACSSNFALFVLARFVGGISKGNISLCM 185

  Fly   133 AYVADTTTVENRSKGYGFVAASFGAGIAFSPSLGN-YLMKSYGSASVILIATITGMINILFIIFA 196
            :.:.|.::|:.|.:|...|..:|..|....|.:|. :.:.|..|.|...:     :.::|....|
  Fly   186 SVITDVSSVKTRGRGMALVGVAFSLGFIVGPMIGALFAIFSDKSGSTWFV-----LPSLLAFGLA 245

  Fly   197 VPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKPTSQNI-VTNKELD 260
            |.:.:||   ...|.|.             .||||:..         |::...|..: :.|....
  Fly   246 VGDLVVL---ACCLRET-------------LPKEKRVK---------EISSALSYGLQLLNFSAI 285

  Fly   261 QQFSKEENLQNDLTEKEKIDNGSLNSSDLWEVLRKSRKDKNLLVIYLITFLSIWPFAGVDSTAPV 325
            .:|:..:|:       .|.|..:|.|                  |.|:.||.::.::|::.|...
  Fly   286 FRFAAIKNV-------PKKDIAALRS------------------IGLVYFLYLFLYSGLEFTVTF 325

  Fly   326 YLKTNMGF-EYEEVSMML--GLLSVL-----------------AITSNILLGYIMNIVGAKWSIR 370
            .:....|: ..::..|.|  |::..|                 ||.|..|:.....:||    :.
  Fly   326 LMYHKFGYTSMDQAKMFLTTGVIMTLLQGSVVRRLPEAKIKGYAIFSLYLIVPAFVVVG----LA 386

  Fly   371 LGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECL 435
            .|..:|:..|..|...|       :..:..|.|::        |.|.:.|.:|:||||...:..|
  Fly   387 EGSRMLYAGMTLFAIST-------AFAVTCLTTLV--------SKYGNDDQKGSVLGIFRSLGAL 436

  Fly   436 SEGVGPAFFGLLFF 449
            :..:||....:.|:
  Fly   437 ARALGPVVGCIAFW 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 98/454 (22%)
MFS_1 30..441 CDD:284993 94/439 (21%)
rtetNP_524429.1 MFS 105..466 CDD:119392 92/433 (21%)
MFS_1 108..442 CDD:284993 90/420 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107739533
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003281
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23504
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.