DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and CG11537

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001097489.1 Gene:CG11537 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster

Alignment Length:523 Identity:182/524 (35%)
Similarity:275/524 (52%) Gaps:107/524 (20%)


  Fly    11 VKVLVN-----RSGIGKASVWHAVIVTFMHYFSWGLLTVPFIEKLSGSFGNRVLLVDGLVYGVRG 70
            ::|:.|     .||||:.||.||::|.|:.:|:|||||:|.|..|:.:|.:...|::|||.|::|
  Fly   234 IRVVCNICCCKSSGIGEPSVHHALVVIFLEFFAWGLLTMPIISTLNQTFPDHTFLMNGLVMGIKG 298

  Fly    71 ILGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWFFAILTVSSICGSTYSSSLAYV 135
            ||.|::.|::||:||..|||..:|:.|..|..|||.|.:.:|||||::::|.....|:|...|||
  Fly   299 ILSFLSAPLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYV 363

  Fly   136 ADTTTVENRSKGYGFVAASFGAGIAFSPSLGNYLMKSYGSASVILIATITGMINILFIIFAVPES 200
            ||.||.|.|||.||..:|:|.|.:..||:|||.||:.||...|:.::|...::::.||:.|||||
  Fly   364 ADVTTPEERSKAYGLASATFAASLVISPALGNALMEMYGDTLVVALSTAIALLDVFFILVAVPES 428

  Fly   201 LVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKELDQQFSK 265
            |                                                                
  Fly   429 L---------------------------------------------------------------- 429

  Fly   266 EENLQNDLTEKEKIDNGSLNSSDLWE------VLRKSRKDKNLLVIYLITFLSIWPFAGVDSTAP 324
                      .||:...|..:...||      .|||...||.:|::.|...||..|.||..|...
  Fly   430 ----------SEKMRPASWGAPISWEQADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMF 484

  Fly   325 VYLKTNMGFEYEEVSMMLGLLSVLAITSNILLGYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHH 389
            ||||..|||.|.|||:.:.::.:|:||..:.||..|.:.|||.:|.:||.|..:|:|::|||:..
  Fly   485 VYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQK 549

  Fly   390 WMYWLSSILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGPAFFGLLFFIF--- 451
            ||.|.:.::|||.:|...|.:|..|:||:|:::|||.|:|:|:..|..|:|||.||::|::|   
  Fly   550 WMMWSAGVVAALGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVD 614

  Fly   452 -QDDSETDLK---------------VNSPISMPFVISAISVFVAIVLSSFIKKDTLGNEETRVAN 500
             .||.::..|               |..|   |||..|:.||.||::|:||.:......|.:.|:
  Fly   615 LNDDHDSHAKSSGSRATNVEKISQHVPGP---PFVFGALCVFCAIIVSAFIPEGQTSTLEKKRAS 676

  Fly   501 ENI 503
            .::
  Fly   677 LDV 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 173/487 (36%)
MFS_1 30..441 CDD:284993 148/417 (35%)
CG11537NP_001097489.1 MFS 256..612 CDD:119392 155/430 (36%)
MFS_1 257..601 CDD:284993 148/418 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134629494
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2358
Isobase 1 0.950 0 Normalized mean entropy S2848
OrthoDB 1 1.010 D139531at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23504
RoundUp 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.