DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and Slc46a1

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001013991.1 Gene:Slc46a1 RGDID:1309472 Length:459 Species:Rattus norvegicus

Alignment Length:463 Identity:74/464 (16%)
Similarity:152/464 (33%) Gaps:142/464 (31%)


  Fly    64 LVYGVRGIL-GFVTTPVMGAISDFHGRKVVMLLA-------------VATTYAPIPFMMLKSWWF 114
            |...|.|.| |...:.::||.||..||:.:::||             |......|.|.:|..   
  Rat    87 LYMNVGGFLVGLFWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLQLHIGFFVLGR--- 148

  Fly   115 FAILTVSSICGSTYSSSLAYVADTTTVENRSKGYGFVAASFGAGIAFSPSLGNYLMKSYGSASVI 179
             |:..:........::|.|.|||.::..:|:.....:.|..|.....:..||.:.:::.|.|:..
  Rat   149 -ALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPF 212

  Fly   180 LIATITGMINILFIIFAVPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVE 244
            .:|....::..|:..|...|:                                            
  Rat   213 WLALAVLIVMTLYAAFCFGET-------------------------------------------- 233

  Fly   245 VNKPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGSLNSSDLWEVLRKSRKDKNLLVIYLI- 308
            |.:|.|..:.|                                        .|..::::.:|:: 
  Rat   234 VKEPKSTRLFT----------------------------------------LRHHRSIVQLYVVP 258

  Fly   309 ------TFLSIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITSNIL--------LGYI 359
                  ..|:::..|       :::...:.|..:::..:..|.:.|...|.::        |.|:
  Rat   259 APEKSRMHLALYSLA-------IFVVVTVHFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYL 316

  Fly   360 MNIVGAK---------WSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASI 415
            .:::|.:         |...:||....|.|:.|.|.|...:.:....|..|:.:......|..|.
  Rat   317 TSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSK 381

  Fly   416 YASPDNRGAVLGIISGIECLSEGVGPAFFGLLFFIFQDDSETDLKVNSPISMPFVISAISVFVAI 480
            ..|...:||:...::.:..|:..:....|..|:         ...:|.....||::.|..:|:..
  Rat   382 LVSESEQGALFSAVACVNSLAMLMASGIFNSLY---------PATLNFMKGFPFLLGAGLLFIPA 437

  Fly   481 VLSSFIKK 488
            :|...::|
  Rat   438 ILIGVLEK 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 73/461 (16%)
MFS_1 30..441 CDD:284993 65/415 (16%)
Slc46a1NP_001013991.1 MFS 73..443 CDD:119392 73/460 (16%)
MFS_1 94..407 CDD:284993 62/408 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.