DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and Y43F8A.5

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_507773.1 Gene:Y43F8A.5 WormBaseID:WBGene00012811 Length:475 Species:Caenorhabditis elegans

Alignment Length:436 Identity:81/437 (19%)
Similarity:138/437 (32%) Gaps:115/437 (26%)


  Fly    71 ILGFVTTPVMGAISDFHGRKVVMLLAVA-------TTYAPIPFMMLKSWWFFAILTVSSICGSTY 128
            :..|.|:..:|.:||...||:..|:...       |....:.:..|..::|.....:....|...
 Worm    72 VSAFFTSRWVGHLSDVKSRKLAFLIPFIGLFISDFTILIQVLYPRLSPYYFIVSEVIYGFFGGYM 136

  Fly   129 SSSLAYVADTTTVEN----RSKGY----GFVAASFGAGIAFSPSLGN--YLMKSYGSASVILIAT 183
            |.:....:..:|:.:    |:||.    |.::.....|...|..|.|  ||    |:||..|:|.
 Worm   137 SITSGAFSIVSTMHSDQRERAKGIARLEGTISLGSTVGFLISSQLKNFGYL----GAASFFLVAH 197

  Fly   184 ITGMINILFIIFAVPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKP 248
            ....::.:|:  ..||...|:||.|                                    ..||
 Worm   198 FIAFMSAVFM--RDPEKPDLQEKCV------------------------------------KRKP 224

  Fly   249 TSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGSLNSSDLWEVLRKSRKDKNLLVIYLITFLSI 313
                          |....:|..|                     :|.....||.::|.....|.
 Worm   225 --------------FCHGTDLLKD---------------------KKPPTSTNLKILYFSFACSY 254

  Fly   314 WPFAGVDSTAPVYLKTNMGFEYEEV----SMMLGLLSVLAITSNILLGYIMNIVGAKWSIRL--- 371
            :.|.|.......|||....:..||.    :|..|:.:::::.   |..::.|:  ....|||   
 Worm   255 FAFIGSTRILFFYLKHRFFWGAEEFGYLKAMNTGMTTIMSLA---LYPFLKNL--GITDIRLAIF 314

  Fly   372 GLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLS 436
            |||...:...::......|..::.......:.....|..:..:.......||....:::.||.|.
 Worm   315 GLLTRSIGRAWYAVAWEGWTVFIVVFFEMFSKFPATAMRSSIATNVGEHERGLAFSLVAVIEALC 379

  Fly   437 EGVGPAFFGLLFFIFQDDSETDLKVNSPISMPFVISAISVFVAIVL 482
            .......|.|.:         .|.:|....:.|||..|.:..||.|
 Worm   380 NLTSSWVFHLAW---------PLSLNVFPQLSFVIMPIIILPAITL 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 81/437 (19%)
MFS_1 30..441 CDD:284993 70/394 (18%)
Y43F8A.5NP_507773.1 MFS 56..418 CDD:119392 81/437 (19%)
MFS_1 56..378 CDD:284993 69/388 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.