DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17637 and slc46a2

Sequence 1:NP_649237.1 Gene:CG17637 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_017953045.1 Gene:slc46a2 XenbaseID:XB-GENE-988711 Length:444 Species:Xenopus tropicalis

Alignment Length:434 Identity:88/435 (20%)
Similarity:150/435 (34%) Gaps:140/435 (32%)


  Fly     9 PLVKVLVNRSGIGKASVWHAVIVTFMHYFSW-----------------------GLLTVPFIEKL 50
            ||:...|:|           :.:.|:..|:|                       |:|.|..:...
 Frog    89 PLLGYFVSR-----------MFLLFVILFNWPIEVMFGSAALNGLTGFFTTYWAGVLAVASLGSS 142

  Fly    51 SGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRK--VVMLLAVATTYAPIPFMMLKSWW 113
            ......|::::: |||||.|.:|.:.:..:....|...:|  |:::|::. .||   |.::.|.:
 Frog   143 ESKRSVRIIIIE-LVYGVAGFVGSLVSGHIFKNFDIANQKGSVLVILSLC-FYA---FSLIYSLF 202

  Fly   114 FFAILTVSSI-CGSTYSSSLAYVADTTTVENRSKGYGFVAASFGAGIAFSPSLGNYLMKSYGSAS 177
            .|.|..:... .|:|.|:.    ..|..::|.::      .|...|:..:.|...:|:..:.|| 
 Frog   203 IFKIPRIEETGPGNTESTE----TSTLLMKNPTE------TSTANGVTMTSSSKVFLVLLFLSA- 256

  Fly   178 VILIATITGMINIL--FIIFAVPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGK 240
            ::..|.:.|.:::|  |||                                     ||.|:. |.
 Frog   257 ILYNAAVGGAVDVLPFFII-------------------------------------KEPLSW-GA 283

  Fly   241 VNVEVNKPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGSLNSSD--------LWEVLRKSR 297
            |.|.........|.....|...|..:.     ||:...|..|.|:.|.        .|..|    
 Frog   284 VEVGYANAAGYLIFVTSFLGVYFFSKR-----LTDFVMIGIGILSFSAGIFIMGFVQWTFL---- 339

  Fly   298 KDKNLLVIYLITFLSIWPFAGVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITSNILLGYIMNI 362
                ..|..::...|:.|...:.|   |..|...|..|.:|.::|.||  |:||..:.|.....:
 Frog   340 ----FYVARVVMMFSLIPLPTIRS---VISKHVQGSSYGKVFVVLQLL--LSITHVVTLISFTKL 395

  Fly   363 VGA--KWSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATI 404
            ..|  ||                   .|...:.|:||:|.|:.|
 Frog   396 YQASLKW-------------------FHGLCFILASIIALLSLI 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 84/419 (20%)
MFS_1 30..441 CDD:284993 84/414 (20%)
slc46a2XP_017953045.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.