DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hpd and HPDL

Sequence 1:NP_730536.1 Gene:Hpd FlyBaseID:FBgn0036992 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_116145.1 Gene:HPDL HGNCID:28242 Length:371 Species:Homo sapiens

Alignment Length:388 Identity:103/389 (26%)
Similarity:173/389 (44%) Gaps:46/389 (12%)


  Fly    13 AGKFLSFDHLTFYVGNAKQAASYYTTRLGFEPLGYQGLETGERRFAKHAVRQNKIVFVFVSAYTP 77
            |...|...|:.|:|...:..|.......||:||..:.:: |.|:.   |:|....||:.......
Human     2 AAPALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVD-GWRQL---ALRSGDAVFLVNEGAGS 62

  Fly    78 DDEEHGLHLMRHGDGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGFVRFATIKT-YGD 141
            .:..:||..........::.|:|.|..|......:.|..|........|.||...:|.:.: .|.
Human    63 GEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAVVSSPAGI 127

  Fly   142 TTHTFVERNGYAGDFLPGFQRSPKDVLLNGLPSTK-LNFIDHVV-----GNQPDLQMESVASWYE 200
            .:.|.:||.||.|.|||||:.      ::..|... ::.:||:.     |:.|.|     ..|:.
Human   128 LSLTLLERAGYRGPFLPGFRP------VSSAPGPGWVSRVDHLTLACTPGSSPTL-----LRWFH 181

  Fly   201 RILQF-HRFWSV-DDSQIHTEYSA------LR---------SIVMANYEETVKMPINEPANGKKK 248
            ..|.| |...|. :|.::..|.:|      ||         |||     .|:.:..:.|....::
Human   182 DCLGFCHLPLSPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIV-----PTLVLAESLPGATTRQ 241

  Fly   249 SQIQEYVEYYGGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDM 313
            .|:::::..:.|.|:||:.|.|.:|:||...:...|.:||..|.:||:  |............:.
Human   242 DQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQ--QPGKERQIRAAGHEP 304

  Fly   314 EVLKKLNILIDFDENGYLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAK 376
            .:|.:..||:|.|:..:|||:|||:.....|.|||:|||....|||.||.::|:.:::.:.|:
Human   305 HLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQSVQEQSAR 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HpdNP_730536.1 4HPPD 17..380 CDD:273528 102/385 (26%)
HPPD_N_like 19..161 CDD:176690 38/143 (27%)
HPPD_C_like 177..372 CDD:176673 61/217 (28%)
HPDLNP_116145.1 4HPPD 10..368 CDD:273528 101/381 (27%)
Glo_EDI_BRP_like 10..148 CDD:301325 38/142 (27%)
HPPD_C_like 158..363 CDD:176673 61/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1087836at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.