DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hpd and hpdb

Sequence 1:NP_730536.1 Gene:Hpd FlyBaseID:FBgn0036992 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001003742.1 Gene:hpdb ZFINID:ZDB-GENE-040808-62 Length:393 Species:Danio rerio

Alignment Length:382 Identity:248/383 (65%)
Similarity:299/383 (78%) Gaps:3/383 (1%)


  Fly     1 MTSYTDKGTKPEAGKFLSFDHLTFYVGNAKQAASYYTTRLGFEPLGYQGLETGERRFAKHAVRQN 65
            ||||.|||.|.|.|||:.|||:||:|||||||||||..:||||||.|:|||||.|....|||:|.
Zfish     1 MTSYIDKGEKHEEGKFICFDHITFWVGNAKQAASYYCNKLGFEPLAYRGLETGSREVVSHAVKQG 65

  Fly    66 KIVFVFVSAYTPDDEEHGLHLMRHGDGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGF 130
            ||::||.||..|.::|.|.||::||||||||||.||:.:.:...|..|||.::::.....|..|.
Zfish    66 KIIYVFTSALNPGNKEMGDHLVKHGDGVKDVAFTVENCDFLVEKARERGAIIIKESHAVEDKFGR 130

  Fly   131 VRFATIKTYGDTTHTFVERNGYAGDFLPGFQRSPK--DVLLNGLPSTKLNFIDHVVGNQPDLQME 193
            |:.|.::||||||||||||.||.|.||||| .:|.  |..|..|||.||:|||||||||||.:|.
Zfish   131 VKMAVVQTYGDTTHTFVERTGYNGLFLPGF-HAPLFCDPFLAKLPSGKLDFIDHVVGNQPDSEMV 194

  Fly   194 SVASWYERILQFHRFWSVDDSQIHTEYSALRSIVMANYEETVKMPINEPANGKKKSQIQEYVEYY 258
            .:..||:|.|.|||||||||.|:.||||||||||:|||||||||||||||.||:|||||||||||
Zfish   195 PIVEWYQRNLLFHRFWSVDDKQLQTEYSALRSIVVANYEETVKMPINEPAMGKRKSQIQEYVEYY 259

  Fly   259 GGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDMEVLKKLNILI 323
            ||.||||||:||.|||.|:.|||.||.||:::|.:||:.|:|:|..|:.:|.||:.:|::|.||:
Zfish   260 GGAGVQHIAMNTSDIISAIRNLKERGMEFMSVPDTYYQQLKEKLKLSKVRIIEDLNILEELKILV 324

  Fly   324 DFDENGYLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAKRGNL 380
            |:|:||||||||||..|||||:|||||||:||.|||||||||||.|||.:|..||||
Zfish   325 DYDDNGYLLQIFTKPVQDRPTVFLEVIQRHNHQGFGAGNFKSLFEAIEADQNARGNL 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HpdNP_730536.1 4HPPD 17..380 CDD:273528 235/365 (64%)
HPPD_N_like 19..161 CDD:176690 84/142 (59%)
HPPD_C_like 177..372 CDD:176673 140/195 (72%)
hpdbNP_001003742.1 4HPPD 19..381 CDD:273528 235/363 (65%)
HPPD_N_like 19..162 CDD:176690 84/144 (58%)
HPPD_C_like 178..372 CDD:176673 139/194 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C276928317
eggNOG 1 0.900 E1_COG3185
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1620
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1087836at2759
OrthoFinder 1 1.000 FOG0003767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129448
Panther 1 1.100 LDO PTHR11959
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.