DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hpd and hpda

Sequence 1:NP_730536.1 Gene:Hpd FlyBaseID:FBgn0036992 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_005171786.1 Gene:hpda ZFINID:ZDB-GENE-040426-986 Length:397 Species:Danio rerio

Alignment Length:383 Identity:249/384 (65%)
Similarity:302/384 (79%) Gaps:4/384 (1%)


  Fly     1 MTSYTDKGTKPEAGKFLSFDHLTFYVGNAKQAASYYTTRLGFEPLGYQGLETGERRFAKHAVRQN 65
            ||||||||.|||.||||:|.|:.|:||||||||.:|..:.|||||.|:|||||.|....|||:|:
Zfish     1 MTSYTDKGEKPERGKFLNFHHIKFWVGNAKQAAVFYCDKFGFEPLAYKGLETGSREVVSHAVKQD 65

  Fly    66 KIVFVFVSAYTPDDEEHGLHLMRHGDGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGF 130
            ||:|||.||..|.:||.|.||::||||||||||.|||.:.:...|..|||.|:::.|.|.|..|.
Zfish    66 KIIFVFESALNPGNEEMGEHLIKHGDGVKDVAFLVEDCDFLVKKAKERGAAVLKEPWVEQDAGGK 130

  Fly   131 VRFATIKTYGDTTHTFVERNG-YAGDFLPGFQRSP--KDVLLNGLPSTKLNFIDHVVGNQPDLQM 192
            |::|.::|||||||||||..| |.|.||||: :.|  :|.||..|||..|:||||:||||||.:|
Zfish   131 VKYAIVQTYGDTTHTFVEYLGPYKGLFLPGY-KEPLFRDPLLPKLPSGHLSFIDHIVGNQPDDEM 194

  Fly   193 ESVASWYERILQFHRFWSVDDSQIHTEYSALRSIVMANYEETVKMPINEPANGKKKSQIQEYVEY 257
            ..|:.||::.|.||||||:||.|||||||||||||:.|||||:||||||||.||||||||||::|
Zfish   195 VPVSDWYQKCLLFHRFWSIDDKQIHTEYSALRSIVVTNYEETIKMPINEPAMGKKKSQIQEYIDY 259

  Fly   258 YGGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDMEVLKKLNIL 322
            .||.|||||||||.:||:|:.||:|||.|||:.|.:|||.|:|:|..::.|:|||::.|::|.||
Zfish   260 NGGPGVQHIALNTSNIIQAIVNLRARGLEFLSAPDNYYESLREKLKTAKIKVKEDLKTLQELKIL 324

  Fly   323 IDFDENGYLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAKRGNL 380
            :|||:.|||||||||..|||||||||||||.||.|||||||||||.|||.:|..||||
Zfish   325 VDFDDKGYLLQIFTKPVQDRPTLFLEVIQRNNHFGFGAGNFKSLFEAIEKDQDARGNL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HpdNP_730536.1 4HPPD 17..380 CDD:273528 234/366 (64%)
HPPD_N_like 19..161 CDD:176690 83/143 (58%)
HPPD_C_like 177..372 CDD:176673 139/195 (71%)
hpdaXP_005171786.1 4HPPD 19..382 CDD:273528 233/364 (64%)
HPPD_N_like 19..163 CDD:176690 83/145 (57%)
HPPD_C_like 179..374 CDD:176673 139/195 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C276927483
eggNOG 1 0.900 E1_COG3185
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 505 1.000 Inparanoid score I1279
OMA 1 1.010
OrthoDB 1 1.010 D1087836at2759
OrthoFinder 1 1.000 FOG0003767
OrthoInspector 1 1.000 T597649
orthoMCL 1 0.900 OOG5_129448
Panther 1 1.100 O PTHR11959
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2577
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.