DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Las and LIP1

DIOPT Version :9

Sequence 1:NP_524183.2 Gene:Las / 40259 FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001318257.1 Gene:LIP1 / 816619 AraportID:AT2G20860 Length:374 Species:Arabidopsis thaliana


Alignment Length:356 Identity:188/356 - (52%)
Similarity:255/356 - (71%) Gaps:18/356 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AEAPIVVATRAASTNAEKLEEIRERLA-KGPNFHDFVQNPDNTRNEWEQYDGKLRREKGEEQRLR 72
            |..|:.|     :.:.:.||.:|.||| :.|:..||:..        :.|..::..:|   :.|.
plant    24 AVTPVTV-----TQSPKSLEALRARLANESPSLTDFIHG--------DTYSVEVGTKK---KPLP 72

  Fly    73 LPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRG 137
            .|.|:|.:||.|:.|.:||.::|:|||.||||||:|||:||||.|||.||.|||||::|||||||
plant    73 KPKWMKESIPGGERYVQIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRG 137

  Fly   138 CRFCSVKTARKPPPLDVNEPVNTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAETVREIKARNS 202
            ||||:|||:|.|||.|.|||.|.|.||||||:||:|:||||||||||.||.|.||||:.:|....
plant   138 CRFCNVKTSRTPPPPDPNEPNNVAEAIASWGVDYVVITSVDRDDLPDQGSGHFAETVQRLKFLKP 202

  Fly   203 NIFVECLVPDFRGNLECVKTIANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQVLTEAKRFNP 267
            .:.:|.|||||||:..||:.::.|||||.||||||||:|..:|||.||:::|:|.||..||.:.|
plant   203 EMLIEALVPDFRGDGGCVEKVSKSGLDVLAHNIETVEELQSFVRDHRANFKQSLDVLRMAKEYAP 267

  Fly   268 -NLITKSSIMLGLGETDEEIENTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEER 331
             ..:||:|:|||.|||.:::..|::.:|.||||.:|.||||:|:.:|:.|.|||||:.|:.:...
plant   268 AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFERYRLL 332

  Fly   332 GNELGFLYTASGPLVRSSYKAGEFFITSILE 362
            |.|:||.|.||||:|||||||||::|.|::|
plant   333 GMEMGFRYVASGPMVRSSYKAGEYYIKSMIE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 34/99 (34%)
PLN02428 19..368 CDD:215236 185/346 (53%)
Radical_SAM 131..307 CDD:100105 105/176 (60%)
LIP1NP_001318257.1 PLN02428 23..372 CDD:215236 188/356 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2642
eggNOG 1 0.900 - - E1_COG0320
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 381 1.000 Inparanoid score I534
OMA 1 1.010 - - QHG60997
OrthoDB 1 1.010 - - D610833at2759
OrthoFinder 1 1.000 - - FOG0003202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100980
Panther 1 1.100 - - LDO PTHR10949
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.