DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Las and LIP1

Sequence 1:NP_524183.2 Gene:Las FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001318257.1 Gene:LIP1 AraportID:AT2G20860 Length:374 Species:Arabidopsis thaliana

Alignment Length:356 Identity:188/357 (53%)
Similarity:255/357 (71%) Gaps:18/357 (5%)


  Fly     9 AEAPIVVATRAASTNAEKLEEIRERLA-KGPNFHDFVQNPDNTRNEWEQYDGKLRREKGEEQRLR 72
            |..|:.|     :.:.:.||.:|.||| :.|:..||:..        :.|..::..:|   :.|.
plant    24 AVTPVTV-----TQSPKSLEALRARLANESPSLTDFIHG--------DTYSVEVGTKK---KPLP 72

  Fly    73 LPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRG 137
            .|.|:|.:||.|:.|.:||.::|:|||.||||||:|||:||||.|||.||.|||||::|||||||
plant    73 KPKWMKESIPGGERYVQIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRG 137

  Fly   138 CRFCSVKTARKPPPLDVNEPVNTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAETVREIKARNS 202
            ||||:|||:|.|||.|.|||.|.|.||||||:||:|:||||||||||.||.|.||||:.:|....
plant   138 CRFCNVKTSRTPPPPDPNEPNNVAEAIASWGVDYVVITSVDRDDLPDQGSGHFAETVQRLKFLKP 202

  Fly   203 NIFVECLVPDFRGNLECVKTIANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQVLTEAKRFNP 267
            .:.:|.|||||||:..||:.::.|||||.||||||||:|..:|||.||:::|:|.||..||.:.|
plant   203 EMLIEALVPDFRGDGGCVEKVSKSGLDVLAHNIETVEELQSFVRDHRANFKQSLDVLRMAKEYAP 267

  Fly   268 -NLITKSSIMLGLGETDEEIENTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEER 331
             ..:||:|:|||.|||.:::..|::.:|.||||.:|.||||:|:.:|:.|.|||||:.|:.:...
plant   268 AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFERYRLL 332

  Fly   332 GNELGFLYTASGPLVRSSYKAGEFFITSILE 362
            |.|:||.|.||||:|||||||||::|.|::|
plant   333 GMEMGFRYVASGPMVRSSYKAGEYYIKSMIE 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 34/100 (34%)
PLN02428 19..368 CDD:215236 185/347 (53%)
Radical_SAM 131..307 CDD:100105 106/177 (60%)
LIP1NP_001318257.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D610833at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127348
Panther 1 1.100 LDO PTHR10949
Phylome 1 0.910 0.688 Consistency score
65.930

Return to query results.
Submit another query.