DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Las and lias

Sequence 1:NP_524183.2 Gene:Las FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001103871.1 Gene:lias ZFINID:ZDB-GENE-040426-1528 Length:397 Species:Danio rerio

Alignment Length:371 Identity:240/372 (65%)
Similarity:292/372 (78%) Gaps:16/372 (4%)


  Fly     9 AEAPIVVATR---AASTNA--------EKLEEIRERLAKGPNFHDFVQNPDNTRNEWEQYDGKLR 62
            |||..|...|   ||||::        ::.:::||   .|.|..||:....:.:::||:|.|.|:
Zfish    26 AEAANVYCNRLSTAASTSSSSSPSTHNDRKKDLRE---DGLNLQDFISGELSEKSKWEEYRGNLK 87

  Fly    63 REKGEEQRLRLPPWLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATI 127
            |||||  ||||||||||.||:||||.|:|..:|||.|.|||||||||||||||||||:.|.||||
Zfish    88 REKGE--RLRLPPWLKTEIPIGKNYNKLKNTLRELNLHTVCEEARCPNIGECWGGGEYATATATI 150

  Fly   128 MLMGDTCTRGCRFCSVKTARKPPPLDVNEPVNTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAE 192
            ||||||||||||||||||||:|||||.:||.|||.|||:|||||:|||||||||:||||:||.|:
Zfish   151 MLMGDTCTRGCRFCSVKTARRPPPLDPDEPYNTAKAIAAWGLDYVVLTSVDRDDIPDGGAEHFAK 215

  Fly   193 TVREIKARNSNIFVECLVPDFRGNLECVKTIANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQ 257
            ||..||.|||.|.||||.|||||:|..|:.||.|||||||||:|||.:|..:|||.||::.|:|.
Zfish   216 TVSNIKERNSKILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDPRANFDQSLS 280

  Fly   258 VLTEAKRFNPNLITKSSIMLGLGETDEEIENTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTP 322
            ||..||:...:::||:||||||||||.:|:.||.:||::||||:|||||||||.:||||.|||||
Zfish   281 VLRHAKKVKSSVLTKTSIMLGLGETDAQIQATLTELRDSGVDCLTLGQYMQPTKRHLKVEEYVTP 345

  Fly   323 EKFKHWEERGNELGFLYTASGPLVRSSYKAGEFFITSILENRKKRQ 368
            |||..||:.|.|:||:||||||||||||||||||:.::||.||..:
Zfish   346 EKFAFWEKVGQEMGFIYTASGPLVRSSYKAGEFFLKNLLEKRKTEE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 54/110 (49%)
PLN02428 19..368 CDD:215236 235/357 (66%)
Radical_SAM 131..307 CDD:100105 122/176 (69%)
liasNP_001103871.1 LIAS_N 53..131 CDD:293486 45/83 (54%)
PLN02428 58..394 CDD:215236 231/340 (68%)
Radical_SAM 154..330 CDD:100105 122/176 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189299437
eggNOG 1 0.900 E1_COG0320
Hieranoid 1 1.000
Homologene 1 1.000 H4997
Inparanoid 1 1.050 488 1.000 Inparanoid score I1355
OMA 1 1.010
OrthoDB 1 1.010 D464271at33208
OrthoFinder 1 1.000 FOG0003219
OrthoInspector 1 1.000 T1052309
orthoMCL 1 0.900 OOG5_127348
Panther 1 1.100 LDO PTHR10949
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R658
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.