DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Las and lias

Sequence 1:NP_524183.2 Gene:Las FlyBaseID:FBgn0029158 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_004910979.1 Gene:lias ID: Length:372 Species:Xenopus tropicalis

Alignment Length:340 Identity:231/341 (68%)
Similarity:276/341 (81%) Gaps:2/341 (1%)


  Fly    28 EEIRERLAKGPNFHDFVQNPDNTRNEWEQYDGKLRREKGEEQRLRLPPWLKTTIPVGKNYAKIKA 92
            :|.:|.:..||:..||:......::.|..|.|.|:|.|||  |||||||::|.||:||||.|:|.
 Frog    33 DEKKELIKNGPDLQDFLSGELTDKSSWAAYKGNLKRLKGE--RLRLPPWVRTEIPMGKNYNKLKN 95

  Fly    93 QMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCSVKTARKPPPLDVNEP 157
            .:|.|.|.|||||||||||||||||||:||.||||||||||||||||||||||||.|||||.:||
 Frog    96 TLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCTRGCRFCSVKTARNPPPLDPDEP 160

  Fly   158 VNTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAETVREIKARNSNIFVECLVPDFRGNLECVKT 222
            .|||.|||.|||||:|||||||||:.|||:||||:||..:|.||..|.:|||.|||||||:.|:|
 Frog   161 FNTAKAIADWGLDYVVLTSVDRDDISDGGAEHIAKTVSLLKERNQTILIECLTPDFRGNLKAVET 225

  Fly   223 IANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQVLTEAKRFNPNLITKSSIMLGLGETDEEIE 287
            :|.|||||||||:|||..|..:|||.||::.|::.||..||...|.||:|:|||||||||||:|.
 Frog   226 VAGSGLDVYAHNVETVPALQRHVRDPRANFDQSVNVLKHAKNVRPELISKTSIMLGLGETDEQIY 290

  Fly   288 NTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTPEKFKHWEERGNELGFLYTASGPLVRSSYKA 352
            :|:|.||||||||:|||||||||.:||||.||:||||||:||:.|||||||||||||||||||||
 Frog   291 STMKALREAGVDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKVGNELGFLYTASGPLVRSSYKA 355

  Fly   353 GEFFITSILENRKKR 367
            ||||:.:::|.||.:
 Frog   356 GEFFLKNLIERRKTK 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LasNP_524183.2 LIAS_N 3..108 CDD:293486 40/80 (50%)
PLN02428 19..368 CDD:215236 231/341 (68%)
Radical_SAM 131..307 CDD:100105 124/176 (70%)
liasXP_004910979.1 LIAS_N 15..111 CDD:293486 40/80 (50%)
PLN02428 19..371 CDD:215236 231/341 (68%)
Radical_SAM 134..330 CDD:302752 140/196 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4997
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D464271at33208
OrthoFinder 1 1.000 FOG0003219
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.