DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5262 and tmem104

Sequence 1:NP_001262109.1 Gene:CG5262 FlyBaseID:FBgn0036988 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_693756.3 Gene:tmem104 ZFINID:ZDB-GENE-070822-4 Length:493 Species:Danio rerio

Alignment Length:506 Identity:229/507 (45%)
Similarity:325/507 (64%) Gaps:33/507 (7%)


  Fly     9 EAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACAN 73
            |....||..||.:::|||||||||||:|..||.|||::|:.:|..||.:|:||.||:|||||.||
Zfish     7 ETGEPYSPFVGLVYMFNLIVGTGALTMPKAFAAAGWVVSVSLITFLAFMSFMTTTFVIEAMAAAN 71

  Fly    74 AIRNWQTLQALRQSRSSAENSENDDNADDVSLASGAEQVGDFERVP-LTIQN-REFHYYQLSHKF 136
            |...|:..:   |...:..:|.:|.:.|:|.:...:|.|   |..| |::|. ....::.:..:.
Zfish    72 AQLRWKRRE---QEEVNDSDSSSDYSDDEVIIRGRSEPV---ETRPILSVQRAANIDHFDIVERV 130

  Fly   137 ELGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFE 201
            |:|:||::|||:.|..|||:|:||||||||:||:|||..||.:|.|        .|.....|..:
Zfish   131 EMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPVSLMEVAC--------GNHSCSAGSVK 187

  Fly   202 NNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLK 266
            .|.:.:||  ..:.|.:.|||.|..|||:.|||.:||.|||||||:||:..||:|||:||.::| 
Zfish   188 YNDTESCW--GPVRRKDAYRVFLAIFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIILAL- 249

  Fly   267 LLISRG-AKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFY 330
            :.|.:| .:|.|:...:.|:|:|||.|||||||.||||||:.||.:|..:|.::..|||:|..||
Zfish   250 IRIGKGHGEGKPSVAQISGVPNLFGVCVYSFMCQHSLPSLVTPISNKQRMSILVMADYILILCFY 314

  Fly   331 ILLAMTGIFAFER--IEDLYTLDFLP-YDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIVAIT 392
            .||::|.||.|:.  :.|:|||:|.. .||..|.       .:.|||.|||:||:||:|||:|:|
Zfish   315 ALLSLTAIFCFDSSLLRDMYTLNFTDNCDVLGVP-------VLRYFLGLFPVFTISTNFPIIAVT 372

  Fly   393 LKNNLQSLF-LDMSQYESYSVILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQYIIP 456
            |:||.::|| .|...|.  .|:.|:.|||:.::||..:.:.|..|.|||..||.|||||||||||
Zfish   373 LRNNWKTLFHRDGGTYP--WVVDRVVFPLITLVPPIIVAFCTHDLESLVGITGAYAGTGIQYIIP 435

  Fly   457 VFLVYFARRTCSELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINL 507
            .|||||:||....:||...||:.:|||:.:.|:.||.:|:..|:..|:.|:
Zfish   436 AFLVYFSRRHLEPVLGRDAVNKHRSPFRHTFWVCFVVLWATFCLMFVTANI 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5262NP_001262109.1 SLC5-6-like_sbd 15..502 CDD:294310 225/494 (46%)
tmem104XP_693756.3 SLC5-6-like_sbd 25..440 CDD:294310 203/441 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188890952
eggNOG 1 0.900 E1_KOG3832
Hieranoid 1 1.000
Homologene 1 1.000 H9802
Inparanoid 1 1.050 420 1.000 Inparanoid score I1730
OMA 1 1.010
OrthoDB 1 1.010 D387878at33208
OrthoFinder 1 1.000 FOG0005771
OrthoInspector 1 1.000 T1053861
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.