DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5262 and tmem104

Sequence 1:NP_001262109.1 Gene:CG5262 FlyBaseID:FBgn0036988 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001016025.1 Gene:tmem104 XenbaseID:XB-GENE-5725015 Length:491 Species:Xenopus tropicalis

Alignment Length:511 Identity:222/512 (43%)
Similarity:320/512 (63%) Gaps:45/512 (9%)


  Fly     9 EAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACAN 73
            |....||..||.:::|||||||||||:|..||.|||::|||:|:.||.:||||.||::||||.||
 Frog     7 ETGELYSPFVGLVYMFNLIVGTGALTMPKAFANAGWLVSLILIIFLAFMSYMTTTFVVEAMAAAN 71

  Fly    74 AIRNWQTLQALRQSRSSAENSENDDNADDVSLASGAEQVGDFERVPLTIQNREF-HYYQLSHKFE 137
            |...|:..    :.....::||:.|:  :|..|||..: .:.:.: |::|.|.. ..:::..:.|
 Frog    72 AQLRWKRW----EKEEDPDSSESSDS--EVPSASGYNR-SEIQPI-LSVQRRGLSDPFEIVERVE 128

  Fly   138 LGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFEN 202
            :|:||:||||:.|..:||:|:||||||||:||:.||..||..|.|...||:.:...      .|.
 Frog   129 MGQMASLFFNKAGVNLFYICIIVYLYGDLAIYATAVPLSLVQVTCFSANGSCSAQA------GER 187

  Fly   203 NTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLKL 267
            |.:..||  ..|.|::.||:.|..|||:.|||.:||||||||||:||:..||:||.:||.::| :
 Frog   188 NDTDPCW--GPIRRIDAYRIYLAVFTLLLGPFTFFNVQKTKYLQILTSLMRWVAFIIMIVLAL-V 249

  Fly   268 LISRG-AKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFYI 331
            .|.:| ..|||....|.||.:|||.|||||||.||||||:.|:..|..::.::.:||.::.|||.
 Frog   250 RIGKGEGAGHPPLAQVSGIRNLFGVCVYSFMCQHSLPSLVTPVSKKKHLTGLVLLDYALVLAFYS 314

  Fly   332 LLAMTGIFAFE--RIEDLYTLDFLPYDVAYVDFWSGLLIC-------IDYFLALFPIFTLSTSFP 387
            ||..|.||.|.  .:.|:|||:|           ||   |       |.|||.|||:||:||:||
 Frog   315 LLCFTAIFCFSSGALMDMYTLNF-----------SG---CSPFVPQVIGYFLGLFPVFTISTNFP 365

  Fly   388 IVAITLKNNLQSLF-LDMSQYESYSVILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGI 451
            |:|:||:||.::|| .|...|.  .::.|:.|||:.::||..:.:.|..|..||:.||:|||.||
 Frog   366 IIAVTLRNNWKTLFHRDGGTYP--WLVDRIVFPLITLVPPVIVAFCTNHLEVLVSITGSYAGNGI 428

  Fly   452 QYIIPVFLVYFARRTCSELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINL 507
            ||:||.|||:.:|:..:.:.|.|:.|:..|||:...|:.||..|::.|...|:.|:
 Frog   429 QYVIPAFLVFCSRKDNALVYGPGLTNKHSSPFRQVGWVWFVLCWALTCFIYVTANI 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5262NP_001262109.1 SLC5-6-like_sbd 15..502 CDD:294310 218/499 (44%)
tmem104NP_001016025.1 SLC5-6-like_sbd 25..436 CDD:294310 198/444 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188894155
eggNOG 1 0.900 E1_KOG3832
Hieranoid 1 1.000
Homologene 1 1.000 H9802
Inparanoid 1 1.050 403 1.000 Inparanoid score I1757
OMA 1 1.010
OrthoDB 1 1.010 D387878at33208
OrthoFinder 1 1.000 FOG0005771
OrthoInspector 1 1.000 T1060656
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2843
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.