DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5262 and TMEM104

Sequence 1:NP_001262109.1 Gene:CG5262 FlyBaseID:FBgn0036988 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_060198.3 Gene:TMEM104 HGNCID:25984 Length:496 Species:Homo sapiens

Alignment Length:509 Identity:221/510 (43%)
Similarity:330/510 (65%) Gaps:36/510 (7%)


  Fly     9 EAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACAN 73
            |....||:.||.:::|||||||||||:|..||.|||::||:::|.|..:|::|.||:|||||.||
Human     7 ETGELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAAN 71

  Fly    74 AIRNWQTLQALRQSRSSAENSENDDNA----DDVSLASGAEQVGDFERVP-LTIQNR-EFHYYQL 132
            |..:|:.::.|::       .|:||::    .||.:....|:.   |:.| |::|.| ..:.:::
Human    72 AQLHWKRMENLKE-------EEDDDSSTASDSDVLIRDNYERA---EKRPILSVQRRGSPNPFEI 126

  Fly   133 SHKFELGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWP 197
            :.:.|:|:||::|||:.|..:||.|:||||||||:||:|||..||..|.|..| |.|:..:   .
Human   127 TDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSAT-GNDSCGV---E 187

  Fly   198 GDFENNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMIC 262
            .|.:.|.:..||  ..:.|::.||:.|..|||:.|||.:|:||||||||:||:..||:||.:||.
Human   188 ADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRWIAFAVMIV 250

  Fly   263 ISLKLLISRG-AKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIII 326
            ::| :.|..| .:|||...:..|:.:|||.|||||||.||||||:.|:..|..:::::.:||::|
Human   251 LAL-IRIGHGQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLDYVLI 314

  Fly   327 CAFYILLAMTGIFAF--ERIEDLYTLDFLPYDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIV 389
            .|||.||:.|.||.|  :.:.|:|||:|...||..       |..:.:||.|||:||:||:|||:
Human   315 LAFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVG-------LAAVRFFLGLFPVFTISTNFPII 372

  Fly   390 AITLKNNLQSLFLDMSQYESYS-VILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQY 453
            |:||:||.::||  ..:..:|. |:.|:.||.:.::||..:.:.|..|.|||..||.||||||||
Human   373 AVTLRNNWKTLF--HREGGTYPWVVDRVVFPTITLVPPVLVAFCTHDLESLVGITGAYAGTGIQY 435

  Fly   454 IIPVFLVYFARRTCSELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINL 507
            :||.||||..||......|.||.|:.:|||:.:.|:.||.:|:..|...|:.|:
Human   436 VIPAFLVYHCRRDTQLAFGCGVSNKHRSPFRHTFWVGFVLLWAFSCFIFVTANI 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5262NP_001262109.1 SLC5-6-like_sbd 15..502 CDD:294310 217/497 (44%)
TMEM104NP_060198.3 SLC5-6-like_sbd <209..443 CDD:294310 116/244 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188892291
eggNOG 1 0.900 E1_KOG3832
Hieranoid 1 1.000
Homologene 1 1.000 H9802
Inparanoid 1 1.050 415 1.000 Inparanoid score I1811
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D387878at33208
OrthoFinder 1 1.000 FOG0005771
OrthoInspector 1 1.000 T1074587
orthoMCL 1 0.900 OOG5_131305
Panther 1 1.100 LDO PTHR16189
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2843
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.