DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5262 and Tmem104

Sequence 1:NP_001262109.1 Gene:CG5262 FlyBaseID:FBgn0036988 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001178584.1 Gene:Tmem104 RGDID:1307953 Length:496 Species:Rattus norvegicus

Alignment Length:505 Identity:217/506 (43%)
Similarity:320/506 (63%) Gaps:34/506 (7%)


  Fly     9 EAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACAN 73
            |....||..||.:::|||||||||||:|..||.|||::|||::|.:..:|::|.||.:||||.||
  Rat     7 ETGELYSPYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLILLVFVGFMSFVTTTFAMEAMAAAN 71

  Fly    74 AIRNWQTLQALRQSRSSAENSENDDNADDVSLASGAEQVGDFERVPLTIQNR-EFHYYQLSHKFE 137
            |...|:.::..::     |:.|:...|.|..|.|........:|..|::|.| ....::::.:.|
  Rat    72 AQLRWKRMEIHKE-----EDDEDSSTASDSDLLSQDNYERAEKRPILSVQRRSSASLFEITERVE 131

  Fly   138 LGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVC----DQTNGTDTNNLMYWPG 198
            :|:||::|||:.|..:||.|:|.||||||:||:|||..||..|.|    :.:.|.||        
  Rat   132 MGQMASMFFNKVGVNLFYFCIITYLYGDLAIYAAAVPVSLMQVTCSVSGNDSCGVDT-------- 188

  Fly   199 DFENNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICI 263
            |.:.|.:..||  ..:.|:::||:.|..||::.|||.:|:||||||||:||:..||:||.:||.:
  Rat   189 DAKYNDTDLCW--GPLRRVDVYRIYLAIFTVLLGPFTFFDVQKTKYLQILTSLMRWIAFAIMIVL 251

  Fly   264 SLKLLISRG-AKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIIC 327
            :| :.|.:| .:|||...|..|:.:|||.|||||||.||||||:.||..|..::::|.:||.:|.
  Rat   252 AL-VRIGKGQGEGHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALIL 315

  Fly   328 AFYILLAMTGIFAF--ERIEDLYTLDFLPYDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIVA 390
            |||.||:.|.||.|  :.:.|:|||:|...||..       |..:.:||.|||:||:||:|||:|
  Rat   316 AFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVG-------LAAVRFFLGLFPVFTISTNFPIIA 373

  Fly   391 ITLKNNLQSLFLDMSQYESYS-VILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQYI 454
            :||:||.::||  ..:..:|. |:.|:.||.:.::||..:.:.|..|.||||.||.||||||||:
  Rat   374 VTLRNNWKTLF--HREGGTYPWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYV 436

  Fly   455 IPVFLVYFARRTCSELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVS 504
            ||.|||:..|:......|||.:|:.:|||..:.|:.||.:|:..|...|:
  Rat   437 IPAFLVFLCRKDTQLTFGSGTINKHRSPFGHTFWVAFVLLWAFSCFFFVT 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5262NP_001262109.1 SLC5-6-like_sbd 15..502 CDD:294310 214/496 (43%)
Tmem104NP_001178584.1 SdaC 21..487 CDD:223884 212/492 (43%)
SLC5-6-like_sbd 25..441 CDD:294310 193/441 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188892833
eggNOG 1 0.900 E1_KOG3832
Hieranoid 1 1.000
Homologene 1 1.000 H9802
Inparanoid 1 1.050 411 1.000 Inparanoid score I1780
OMA 1 1.010
OrthoDB 1 1.010 D387878at33208
OrthoFinder 1 1.000 FOG0005771
OrthoInspector 1 1.000 T1088232
orthoMCL 1 0.900 OOG5_131305
Panther 1 1.100 LDO PTHR16189
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.