DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5262 and C03A3.2

Sequence 1:NP_001262109.1 Gene:CG5262 FlyBaseID:FBgn0036988 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_509879.2 Gene:C03A3.2 WormBaseID:WBGene00007267 Length:492 Species:Caenorhabditis elegans

Alignment Length:532 Identity:183/533 (34%)
Similarity:276/533 (52%) Gaps:93/533 (17%)


  Fly    13 TYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACANAIRN 77
            |||..||.:::||||||||||.||..|..|||:||:.::...|.:||:..||:|||::.|||:  
 Worm    12 TYSQTVGLLYVFNLIVGTGALALPKAFQTAGWLLSITLLTFSAFMSYVAATFVIEALSVANAV-- 74

  Fly    78 WQTLQALRQSRSSAENSENDDNADDVSLASGAEQVGDFERVPLTIQNREFHYYQLSHKFELGEMA 142
                  |.:.|..        ..|||.:|.|          |.|        :::|.|.|:.|||
 Worm    75 ------LSKKRRV--------EYDDVVVADG----------PST--------FEISKKVEVSEMA 107

  Fly   143 TLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFENNTSLA 207
            ::|.::...|..|..:|:||:|||:|||..|.:|..::||...|.:..            .:|..
 Worm   108 SMFLSKVSLVFSYFAIIIYLFGDLAIYSTTVPKSAMNIVCATINASTV------------KSSDP 160

  Fly   208 C---WKEHTISRLNMYRVLLIGFTLIFG-PFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLKLL 268
            |   |.| .::|:.:||..:|.|.::.. |.|...:.||:::|::|...||.||.|||.::...|
 Worm   161 CHESWPE-ILTRMTVYRFFVIIFVVVVCLPMVIAGITKTRHIQIMTTLSRWAAFILMISLATMQL 224

  Fly   269 ISRGAKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFYILL 333
            .|.||..||..:|.:|..||||..||:||||||:|||:.|:|.|..|...:::.|.::..||..|
 Worm   225 SSDGAAAHPPAYNFHGFGSLFGCAVYAFMCHHSIPSLITPMRTKDNVFGKIALVYGVVGVFYFTL 289

  Fly   334 AMTGIFAFERIEDLYTLDFLPYDVAYVDFWSG----LLICIDYFLALFPIFTLSTSFPIVAITLK 394
            ::||.||||.::|:|||:|         |..|    :...||||||||||.||::|:||:|:||.
 Worm   290 SLTGAFAFEHVQDIYTLNF---------FHDGNTSFIYSIIDYFLALFPIITLTSSYPIIALTLI 345

  Fly   395 NNL---------------QSLFLDMSQYESYSV--------------ILRLCFPLLAIIPPFCIT 430
            ||.               :||....|..|....              :..:..|.|.:..|..::
 Worm   346 NNFNVVKDILCPKVGQENESLLEADSLVEDNDTDDEREARNARNEKSVFDVLVPALVLALPTFLS 410

  Fly   431 YFTESLSSLVAFTGTYAGTGIQYIIPVFLVYFARRTCSELLGSGVVNRFKSPFKSSAWLVFVFIW 495
            ..|:.:..|.:.||::.|..:|:.||..||..||:....:|...|..:..|||:|..|:|.:..|
 Worm   411 LLTDDMLLLASITGSFPGVAVQFAIPCLLVTAARKHARSVLNFPVPRKNNSPFQSPIWIVLISSW 475

  Fly   496 SILCVCLVSINL 507
            :...:.:|.:||
 Worm   476 AGFSMIMVLLNL 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5262NP_001262109.1 SLC5-6-like_sbd 15..502 CDD:294310 178/524 (34%)
C03A3.2NP_509879.2 SLC5-6-like_sbd 22..>332 CDD:294310 137/366 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188880438
eggNOG 1 0.900 E1_KOG3832
Hieranoid 1 1.000
Homologene 1 1.000 H9802
Inparanoid 1 1.050 298 1.000 Inparanoid score I1627
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D387878at33208
OrthoFinder 1 1.000 FOG0005771
OrthoInspector 1 1.000 T476566
orthoMCL 1 0.900 OOG5_131305
Panther 1 1.100 LDO PTHR16189
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2843
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.