DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and Dpep1

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_446043.1 Gene:Dpep1 RGDID:620324 Length:410 Species:Rattus norvegicus

Alignment Length:366 Identity:105/367 (29%)
Similarity:189/367 (51%) Gaps:54/367 (15%)


  Fly   123 LLTESPLIEGSWKPP------------------STMSLNSSNLFEVRQNHIGAVLWPIAVPCGAQ 169
            ::..:|:|:|....|                  |.::...:|:.::|...:|...|...:||..|
  Rat    26 IMRTTPVIDGHNDLPWQMLTLFNNQLRKSEANLSALAETHTNIPKLRAGFVGGQFWSAYMPCDTQ 90

  Fly   170 YLDAVQLTLEGIDRAKRITAA-TDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRS 233
            ..|||:..||.||...|:... .::...|.::.::.|...||:||.|:|:.|||.:.:|..|||:
  Rat    91 NKDAVKRILEQIDVIHRMCQLYPETFECVTNSSDILQAFRRGKVASLIGVEGGHLIDSSLGVLRT 155

  Fly   234 IYLLGARFVSITSLECTTPWAAAAIRRPDYLV----EENVTNSFNEFGQTMLFEMNRLGMLVEIS 294
            :|.||.|::::|. .|.||||      .::||    :|..:...:.||:.:|.||||||:::::|
  Rat   156 LYHLGMRYLTLTH-NCNTPWA------DNWLVDKGDDEAESQGLSPFGKLVLNEMNRLGVMIDLS 213

  Fly   295 MLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLER----CGD 355
            .:|.|.|...|:.:||||:.::::..|:|  .:..::||.||.|:.....::::|...    |.|
  Rat   214 HVSVATMKDALQLSKAPVIFSHSSAYSVC--PHRRNVPDDVLQLVKSTNSLVMVNFYNQFVSCSD 276

  Fly   356 RTLGVREAITAINYVRKVAGVDHIGLGG-------AP------KSYALLLAELARDRVWGNAAIK 407
             :..:.:....:::::||||...:||||       .|      ..|..|:|||.| |.|....::
  Rat   277 -SATLSQVADHLDHIKKVAGAGAVGLGGDYDGVTNLPVGLEDVSKYPDLIAELLR-RNWTETEVR 339

  Fly   408 KLVGGNVMRILREIETLKNRLPL-YEEWIPHESIESNSYCR 447
            .|:..|::|:...:|.:.|.:.: .||.||.|.::.:  ||
  Rat   340 GLLAENLLRVFSAVELVSNIMQVPEEETIPVEKLDGS--CR 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 96/337 (28%)
Dpep1NP_446043.1 Peptidase_M19 26..352 CDD:279569 96/337 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.