DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and CG6154

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_651471.2 Gene:CG6154 FlyBaseID:FBgn0039420 Length:434 Species:Drosophila melanogaster

Alignment Length:409 Identity:134/410 (33%)
Similarity:217/410 (53%) Gaps:59/410 (14%)


  Fly    91 VLVCIAMAGGIPLALQLRSSSLLEARLAFIRRLLTESPLIEG----SWK---------------- 135
            :|.|.|.|.........:::...:.|:..:|.:|.|.|||:|    .|.                
  Fly    29 ILRCSAGAASSASGGGSKTADDFDFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGG 93

  Fly   136 ------PPSTMSLNSSNLFEVRQNHIGAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAA-TDS 193
                  |.|:.:.:.::|..:::..:.|..|....||.:|:|||||||||.||..:|:... ...
  Fly    94 DLRELAPWSSSAWSHTDLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRRLVQLYPHH 158

  Fly   194 MHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWA-AAA 257
            |.:|.:|..:||||..|::|.|:|:.||||:|||.:|||..|.||||::::|. .|.|||| ...
  Fly   159 MALVTTASGIEQTHRTGKIASLIGVEGGHAIGTSLSVLRMFYQLGARYLTLTH-TCNTPWADCCK 222

  Fly   258 IRRPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSM 322
            :..|.....   ....::||:.::.|||||||:|::|.:|...||..|..::||::.::::..::
  Fly   223 VDEPGKYPH---IGGLSQFGKLVVKEMNRLGMIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAI 284

  Fly   323 CNSSNIASIPDHVLSLLPENGGVILL----NLERC-GDRTLGVREAITAINYVRKVAGVDHIGLG 382
            ||||.  ::|||||..:..|||::::    :...| |..||  .:.:..||::|:|||:||:|:|
  Fly   285 CNSSR--NVPDHVLQRIAINGGLVMVAFYPHFVSCSGQATL--HDVVAHINHIREVAGIDHVGIG 345

  Fly   383 G-------APK------SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRLPL---- 430
            .       .||      .|..|.|.|.....|....|.||.|.|::|:.:|:|.:::::.|    
  Fly   346 AGYDGVNLVPKGLEDVSKYPHLFAALLESDKWSEEDIAKLAGRNLIRVFKEVEAVRDQMELLRVA 410

  Fly   431 -YEEWIPHESIESNSYCRY 448
             .::.||.|.|...|||||
  Fly   411 PIDQSIPAEDIMGRSYCRY 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 116/344 (34%)
CG6154NP_651471.2 Peptidase_M19 61..396 CDD:279569 116/343 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6062
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10443
RoundUp 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.