DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and Dpep3

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001008384.1 Gene:Dpep3 RGDID:1305484 Length:488 Species:Rattus norvegicus

Alignment Length:354 Identity:108/355 (30%)
Similarity:192/355 (54%) Gaps:57/355 (16%)


  Fly   112 LLEARLAFIRRLLTESPLIEGSWKPP----------------STMSLNSSNLFEVRQNHIGAVLW 160
            |.|..||.:|    :.||::|....|                ...:...::|..:|...:||..|
  Rat    77 LREQALALMR----DFPLVDGHNDLPLLLRELFQNKLQDVNLHNFTRGQTSLDRLRDGLVGAQFW 137

  Fly   161 PIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALG 225
            ...:||..|..|||::.||.||..:|:.:|...:.:|.|||.:..|.   ::|.|:|:.|||:|.
  Rat   138 SAYIPCQTQDRDAVRVALEQIDLIRRMCSAYPELELVTSADGLNSTQ---KLACLIGLEGGHSLD 199

  Fly   226 TSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGML 290
            ||.|||||.|.||.|::::| ..|:||||.:|.:...:.. .|: :....||:.::.||||:||:
  Rat   200 TSLAVLRSFYELGVRYLTLT-FTCSTPWAESATKFRHHFY-TNI-SGLTSFGEKVVEEMNRIGMM 261

  Fly   291 VEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLERCGD 355
            :::|..|:..:...|:.::|||:.:::...|:|:  |:.::||.:|.||.:|||::::.|     
  Rat   262 IDLSHASDTLVKQTLEASRAPVIFSHSAARSVCD--NLLNVPDDILQLLKKNGGIVMVTL----- 319

  Fly   356 RTLGVREAITAIN---------YVRKVAGVDHIGLGGA-------PK------SYALLLAELARD 398
             ::||.:.....|         ::|.|.|.:.||:||:       |:      :|.:||.||.| 
  Rat   320 -SMGVLQCSLLANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLLEELLR- 382

  Fly   399 RVWGNAAIKKLVGGNVMRILREIETLKNR 427
            |.||...::.::.||::|:.|::|.::.:
  Rat   383 RGWGEQELQGVLRGNLLRVFRQVEQVREK 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 102/336 (30%)
Dpep3NP_001008384.1 Podoplanin 26..>76 CDD:283467
Peptidase_M19 83..404 CDD:279569 104/340 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.