DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and CG42750

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_724101.4 Gene:CG42750 FlyBaseID:FBgn0261804 Length:1068 Species:Drosophila melanogaster

Alignment Length:404 Identity:133/405 (33%)
Similarity:215/405 (53%) Gaps:54/405 (13%)


  Fly    69 SESSAERPERSRGRKILLGVGVVLVCIAMAG-GIPLALQLRSSSLLEARLAFIRRLLTESPLIEG 132
            |.||.....|....|..|.|..:|:.|..|. .:||||::.:|:..|.||....:||.:.|||:|
  Fly   646 SSSSGTNSFRFDAAKHWLAVSSILLIIGAASVAVPLALRVAASAPFEERLRVAVQLLDQVPLIDG 710

  Fly   133 ----SWK----------------------PPSTMSLNSSNLFEVRQNHIGAVLWPIAVPCGAQYL 171
                .|.                      |......:.::|..:::..|.|..|...|||.||:.
  Fly   711 HNDLPWNIRKFLHNKLNDFNFDEDLRNVMPWGRSHWSHTDLTRLKKGRISAQFWAAYVPCEAQHR 775

  Fly   172 DAVQLTLEGIDRAKRIT-AATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSIY 235
            ||||||||.||..||:| ..:..:....||.::...|...::..|.|:.|||:||.|.||||::|
  Fly   776 DAVQLTLEQIDVIKRLTDRYSPQLTTCTSAQDIIDAHKNQQLCSLTGVEGGHSLGGSLAVLRTLY 840

  Fly   236 LLGARFVSITSLECTTPWAAAAIR-RPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEA 299
            .:|.|::::|| .|.||||.::.. .|.:.::.   .....||:|::.|||||||:|::|.:|:.
  Fly   841 AIGVRYMTLTS-TCHTPWADSSYADAPTFNMKH---GGLTIFGKTIIREMNRLGMMVDLSHVSKG 901

  Fly   300 AMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLNLE----RCGDRTLGV 360
            .|...|:.::|||:.::::...:||:|.  ::.|.:|..|.:|||::::|..    .|.|.:. |
  Fly   902 TMRDALEVSEAPVIFSHSSAYELCNTSR--NVQDDILQALAKNGGLVMVNFYSKFLSCSDNST-V 963

  Fly   361 REAITAINYVRKVAGVDHIGLGG-------APK------SYALLLAELARDRVWGNAAIKKLVGG 412
            .:|:..||::::|||:||:|||.       .||      ||..|.|||.... |....:.||.||
  Fly   964 HDAVAHINHIKRVAGIDHVGLGAGYDGINYTPKGLEDVSSYPTLFAELLGGG-WTIDELTKLAGG 1027

  Fly   413 NVMRILREIETLKN 426
            |.:|:::::|.|::
  Fly  1028 NFLRVMQQVEKLRD 1041

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 113/343 (33%)
CG42750NP_724101.4 Peptidase_M19 701..1035 CDD:279569 113/342 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10443
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.