DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and Dpep2

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_006531144.1 Gene:Dpep2 MGIID:2442042 Length:611 Species:Mus musculus

Alignment Length:537 Identity:146/538 (27%)
Similarity:246/538 (46%) Gaps:122/538 (23%)


  Fly     3 PVPSREFLEVHPLHQHQPHCKQQCFVFTEIADIELPAEITKFGGGNEKIRCSNGGIP-TYSSKKD 66
            |.|::...|..|:.:..|  |:|........|:..|      |....:::..:||.. :..|...
Mouse    70 PTPAKAEQEEKPVPRRAP--KRQRVQEESDQDLGCP------GAKVPRLKLKHGGKGLSRPSSVP 126

  Fly    67 SCSESSAERPERSRGRKIL-LGVGVVLVCIAMAG---------------------GIPLAL---- 105
            :||..|.......:|..:| .|:.|.|:.:.:.|                     .||.||    
Mouse   127 ACSALSKMSLTGLKGHWVLGHGLSVFLLVLLLLGPSQPLIWTQTKPGFSGASTTSSIPRALTKPD 191

  Fly   106 --------------QLRSSSLLEARLAFIRRLLTESPLIEGSWKPPSTM------SLNSSN---- 146
                          .||..:         |.|:.|.|||:|....|..:      .|..:|    
Mouse   192 ISSIPTTPGNPNFPDLRDRA---------RALMQEFPLIDGHNDMPLVLRQFYQNGLQDANLRNF 247

  Fly   147 ------LFEVRQNHIGAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQ 205
                  |..::...:||..|...|||..|..||::||||.||..:||.|:...:.:|.|...:..
Mouse   248 THGQTSLDRLKDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRICASYSELELVTSVKALNS 312

  Fly   206 THIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVT 270
            |.   ::|.|:|:.|||:|..|.|||||.||||.|::::|. .|.||||..: .:..:....:||
Mouse   313 TQ---KLACLIGVEGGHSLDNSLAVLRSFYLLGVRYLTLTH-TCNTPWAETS-SKGVHAFYSSVT 372

  Fly   271 NSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHV 335
             ....||:.::.|||||||:|::|.:|:||....|:.::|||:.:::...::|  .|..::||.:
Mouse   373 -GLTSFGEKVVAEMNRLGMMVDLSHVSDAAARRALEVSQAPVIFSHSAARAVC--PNARNLPDDL 434

  Fly   336 LSLLPENGGVILLNLERCGDRTLGVREAITAIN---------YVRKVAGVDHIGLGG-------A 384
            |.||.:|||::::..      ::||.......|         ::|.|.|.:.||:||       .
Mouse   435 LQLLKKNGGIVMVTF------SVGVLPCNPLANVSTVADHFDHIRSVIGSEFIGIGGDYDGTKQF 493

  Fly   385 PK------SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNR----LPLYEEWIPHES 439
            |:      :|.:|:.||.| |.|....::.::.||::|:.|::|.::::    .|| |:.||.|.
Mouse   494 PQGLEDVSTYPVLIEELLR-RGWNEQELQGILRGNLLRVFRQVEQVRDKSKWQSPL-EDMIPEEQ 556

  Fly   440 IESNSYC------RYPE 450
            ::|..:.      ::||
Mouse   557 LDSACHSALRPQKQHPE 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 107/336 (32%)
Dpep2XP_006531144.1 Peptidase_M19 213..534 CDD:279569 107/336 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.