| Sequence 1: | NP_649221.1 | Gene: | CG5282 / 40256 | FlyBaseID: | FBgn0036986 | Length: | 451 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008770709.1 | Gene: | Dpep2 / 291984 | RGDID: | 1305746 | Length: | 566 | Species: | Rattus norvegicus | 
| Alignment Length: | 382 | Identity: | 115/382 - (30%) | 
|---|---|---|---|
| Similarity: | 195/382 - (51%) | Gaps: | 72/382 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   121 RRLLTESPLIEGSWKPPSTM------SLNSSN----------LFEVRQNHIGAVLWPIAVPCGAQ 169 
  Fly   170 YLDAVQLTLEGIDRAKRITAATDSMHIVESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSI 234 
  Fly   235 YLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEA 299 
  Fly   300 AMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVI-------------LLNLE 351 
  Fly   352 RCGDRTLGVREAITAINYVRKVAGVDHIGLGG-------APK------SYALLLAELARDRVWGN 403 
  Fly   404 AAIKKLVGGNVMRILREIETLKNR----LPLYEEWIPHESIESNSYC------RYPE 450 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG5282 | NP_649221.1 | Peptidase_M19 | 123..420 | CDD:395996 | 102/338 (30%) | 
| Dpep2 | XP_008770709.1 | Peptidase_M19 | 164..485 | CDD:279569 | 102/339 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2355 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1272387at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR10443 | 
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 6 | 5.880 | |||||