DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and SPAC3A11.10c

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_594193.1 Gene:SPAC3A11.10c PomBaseID:SPAC3A11.10c Length:409 Species:Schizosaccharomyces pombe

Alignment Length:436 Identity:109/437 (25%)
Similarity:184/437 (42%) Gaps:103/437 (24%)


  Fly    69 SESSAERP-----ERSRGRKI----LLGVGVVLVCIAMAG-----GIPLALQLRSSSLLEARLAF 119
            |:|..|.|     ::.|.|:|    ||...::|..:...|     ..|           |.:..|
pombe     3 SDSKLELPLPVNQQKPRRRRILKVHLLIAALILSAVGYLGKGKWIWTP-----------ERKAHF 56

  Fly   120 IRRLLTESPLIEGSWKPPSTMSLNSSN---------------LFEVRQNHIGAVLWPIAVPCGA- 168
            :   ||..|||:|....|..:..|..|               :|.:||.|:|...|.:.|.|.: 
pombe    57 V---LTHFPLIDGHNDLPIYLRENYDNRLLNISLEHLPGQTDIFRLRQGHVGGQFWSVFVECPSL 118

  Fly   169 ------------QYLDAVQLTLEGIDRAKRITA-ATDSMHIVESADEMEQTHIRGEVAVLMGISG 220
                        :| :||..||:.||..||:.. ...:..:.:.:.:::...:|..::.:|||.|
pombe   119 DSNSSLSWNRTGEY-EAVTQTLQQIDVVKRMALYYPKTFSLTDHSGKVKFDFLRNHISSMMGIEG 182

  Fly   221 GHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEENVTN-SFNEFGQTMLFEM 284
            .|.:..|.::||..|.||.|:.::.. .|...:|.||       |:...|| ..:..|:.::.||
pombe   183 LHQIAGSPSILRQFYDLGVRYATLAH-NCDNVFADAA-------VDGKRTNKGLSPAGRDIVREM 239

  Fly   285 NRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGVILLN 349
            |||||:|::|..:...|...|..:.||...::::...:.:...  ::||.||..:.|..||:::|
pombe   240 NRLGMIVDLSHTTPETMHQALDVSVAPAFFSHSSAKGVYDHPR--NVPDDVLIRVKETDGVVMVN 302

  Fly   350 L------ERCGDRTLGVREAITAINYVRKVAGVD----HIGLGG-------APK------SYALL 391
            .      ....:.|:.     |.:.::..:|.|.    ||||||       .||      .|..|
pombe   303 FYPAFISPHPENATID-----TVVEHIMHIANVTGSYRHIGLGGDFDGIDMVPKGLEDVSKYPDL 362

  Fly   392 LAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRL---PLYEEW 434
            ..:|| :|......:..:.|.||:|:.:..|.|.:.:   ||  ||
pombe   363 FVKLA-ERGLSITELADIAGRNVLRVWKTTEDLGHSIHEPPL--EW 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 89/351 (25%)
SPAC3A11.10cNP_594193.1 Peptidase_M19 57..389 CDD:279569 89/352 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.