DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and SPCC965.12

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001342728.1 Gene:SPCC965.12 PomBaseID:SPCC965.12 Length:416 Species:Schizosaccharomyces pombe

Alignment Length:346 Identity:97/347 (28%)
Similarity:168/347 (48%) Gaps:53/347 (15%)


  Fly   145 SNLFEVRQNHIGAVLWPIAVPC-GAQYL--------DAVQLTLEGIDRAKRITAA-TDSMHIVES 199
            ::|.::||..:|...:...:.| ...||        ..|:.|||.||..:|:... .:.:..|:.
pombe    59 TDLVKMRQGQVGVQFFSCFIECKNPNYLYQDFDTPTTVVRDTLEQIDVTRRLVCKYNNDLKFVDC 123

  Fly   200 ADE-MEQTHIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDY 263
            ||: :......|::|:.:|:.|.|.:.||.||||..|.||.|::::|. .|..|:|.||      
pombe   124 ADDAIAAFRNNGKIAIALGVEGLHQVDTSLAVLRQYYSLGVRYITLTH-NCDNPFATAA------ 181

  Fly   264 LVEENVT-----NSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMC 323
               .::|     ...:.:|...:||||||||:|::|.:|...|...|...||||:.::::..:: 
pombe   182 ---SSITGGLPDRGLSAYGIECIFEMNRLGMMVDLSHVSHRTMHDALDVTKAPVIFSHSSAYTL- 242

  Fly   324 NSSNIASIPDHVLSLLPENGGVILLN-----LERCGDRTLGVREAITAINYVRKVAGVDHIGLG- 382
             :.:..::.|.||..|..||||:.:|     :.:.|.....:.:|...|.::.||||.:|:||| 
pombe   243 -TEHERNVRDDVLERLKTNGGVVQVNFYQDFIRKPGSDRATIDDAADHILHIIKVAGWEHVGLGS 306

  Fly   383 ---GAPK---------SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRL-----PL 430
               |.|:         .|..|:.::.......|..|:.|:|.||:|:.::.|.:..:|     |:
pombe   307 DFDGIPQGPKGLEDVSKYPDLICKIIERTNATNEQIEGLMGLNVLRVWKKTELVALQLSKKLEPI 371

  Fly   431 YEEWIPHESIESNSYCR-YPE 450
            ...| .....|..||.: :||
pombe   372 ESSW-SGRKWEFYSYAKEFPE 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 88/309 (28%)
SPCC965.12NP_001342728.1 Peptidase_M19 18..356 CDD:279569 88/309 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.