DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and Dpep1

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_031902.2 Gene:Dpep1 MGIID:94917 Length:410 Species:Mus musculus

Alignment Length:379 Identity:106/380 (28%)
Similarity:195/380 (51%) Gaps:56/380 (15%)


  Fly   109 SSSLLEARLAFIRRLLTESPLIEG----SW-----------KPP---STMSLNSSNLFEVRQNHI 155
            |.|..:..:|.:|    .:|:|:|    .|           :|.   :.::...:|:.:::...:
Mouse    16 SDSFRDQAVAIMR----TTPVIDGHNDLPWQLLNLFNNQLLRPDADLNKLAQTHTNIPKLKAGFV 76

  Fly   156 GAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAA-TDSMHIVESADEMEQTHIRGEVAVLMGIS 219
            |...|...:||..|..|||:..||.:|...|:... .::...|.::.::.|...||:||.|:|:.
Mouse    77 GGQFWSAYMPCDTQNKDAVKRILEQMDVIHRMCQLYPETFMCVTNSSDILQAFRRGKVASLIGVE 141

  Fly   220 GGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLV----EENVTNSFNEFGQTM 280
            |||.:.:|..|||::|.||.|::::|. .|.||||      .::||    :|..::..:.||:.:
Mouse   142 GGHLIDSSLGVLRTLYHLGMRYLTLTH-NCNTPWA------DNWLVDRGDDEAESHGLSPFGKRL 199

  Fly   281 LFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPDHVLSLLPENGGV 345
            |.||||||:::::|.:|.|.|...|:.::|||:.::::..|:|  .:..::||.||.|:.....:
Mouse   200 LNEMNRLGVMIDLSHVSVATMKDALQISRAPVIFSHSSAYSLC--PHRRNVPDDVLQLVKNTSSL 262

  Fly   346 ILL----NLERCGDRTLGVREAITAINYVRKVAGVDHIGLGG-------AP------KSYALLLA 393
            :::    |...|.| :..:.:....:::::||||...:||||       .|      ..|..|:|
Mouse   263 VMVNFFSNFVSCSD-SATLPQVADHLDHIKKVAGAGAVGLGGDYDGVTMLPVGLEDVSKYPDLIA 326

  Fly   394 ELARDRVWGNAAIKKLVGGNVMRILREIETLKNRLPLYEEWIPHESIESNSYCR 447
            ||.| |.|....::.|:..|::|:..|:|.:.|.:...|| :|....|.:..||
Mouse   327 ELLR-RNWTETEVRGLLADNLIRVFSEVELVSNNMQSPEE-VPITLKELDGSCR 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 93/338 (28%)
Dpep1NP_031902.2 Peptidase_M19 25..352 CDD:279569 95/342 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6062
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.