DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5282 and dpep2

Sequence 1:NP_649221.1 Gene:CG5282 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_003199021.2 Gene:dpep2 ZFINID:ZDB-GENE-120419-2 Length:425 Species:Danio rerio

Alignment Length:395 Identity:118/396 (30%)
Similarity:197/396 (50%) Gaps:65/396 (16%)


  Fly    93 VCIAMAGGIPLALQLRSSSLLEARLAFIRR---LLTESPLIEG--SW----KPPSTMSLNSSNLF 148
            :||::             |||...::...|   ::|:.|||:|  .|    :......|...||:
Zfish    18 ICISL-------------SLLHGVISETSRALDMMTKYPLIDGHNDWALHLRKHDDNKLTKVNLY 69

  Fly   149 EVRQ----------NHIGAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHIVESADEM 203
            ...|          .|:|..::...|.|.||..|||:||||.||..:|:......:.:|.:::.|
Zfish    70 NYPQGATDITRLIAGHVGGQVFSAYVLCTAQDKDAVRLTLEQIDVIRRMCTEKPELELVTTSEGM 134

  Fly   204 EQTHIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRPDYLVEEN 268
            :::   .::|.|:.:.|||::.:|.|.||..|.||.|.:|:|. .|.||||.::  ...|...:.
Zfish   135 KKS---TKIACLISVEGGHSIDSSLAALRMFYQLGVRSMSLTH-TCNTPWAKSS--SSFYQHYQW 193

  Fly   269 VTNSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSSNIASIPD 333
            |.||..|||:.::.|||||||||::|..|.....||||...|||:.::::..::||  |:.::||
Zfish   194 VNNSLTEFGKEVVHEMNRLGMLVDLSHSSWETARAVLKHTAAPVIFSHSSAYAVCN--NVRNVPD 256

  Fly   334 HVLSLLPENGGVILLNLER----CGDRTLGVREAITAINYVRKVAGVDHIGLG-------GAPK- 386
            .:|.||..|||:|::||..    |......|.......:::::|.|.:.||:|       |.|: 
Zfish   257 DLLLLLKRNGGLIMVNLYNNFIACSSNKANVSIVADHFDHIKRVIGAESIGIGADYDGAQGFPEG 321

  Fly   387 -----SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRL----PLYEEWIPHESIES 442
                 .|..|:.||.. |.|....:..::..|.:::...:|.:::.:    |...| ||.  :|:
Zfish   322 LEDVSKYPALIEELIA-RNWTEQELAGVLRLNFLKVFEMVEKIRDDMLDTSPSEVE-IPF--LEA 382

  Fly   443 NSYCR 447
            |:.||
Zfish   383 NNSCR 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 122..420 CDD:279569 104/334 (31%)
dpep2XP_003199021.2 Peptidase_M19 39..358 CDD:279569 103/328 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2355
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1272387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10443
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.