DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5282 and dpep2

DIOPT Version :9

Sequence 1:NP_649221.1 Gene:CG5282 / 40256 FlyBaseID:FBgn0036986 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_068078794.1 Gene:dpep2 / 100534995 ZFINID:ZDB-GENE-120419-2 Length:481 Species:Danio rerio


Alignment Length:337 Identity:106/337 - (31%)
Similarity:175/337 - (51%) Gaps:43/337 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LNSSNLFEVRQ----------NHIGAVLWPIAVPCGAQYLDAVQLTLEGIDRAKRITAATDSMHI 196
            |...||:...|          .|:|..::...|.|.||..|||:||||.||..:|:......:.:
Zfish   119 LTKVNLYNYPQGATDITRLIAGHVGGQVFSAYVLCTAQDKDAVRLTLEQIDVIRRMCTEKPELEL 183

  Fly   197 VESADEMEQTHIRGEVAVLMGISGGHALGTSTAVLRSIYLLGARFVSITSLECTTPWAAAAIRRP 261
            |.:::.|:::   .::|.|:.:.|||::.:|.|.||..|.||.|.:|:|. .|.||||.::  ..
Zfish   184 VTTSEGMKKS---TKIACLISVEGGHSIDSSLAALRMFYQLGVRSMSLTH-TCNTPWAKSS--SS 242

  Fly   262 DYLVEENVTNSFNEFGQTMLFEMNRLGMLVEISMLSEAAMLAVLKTAKAPVLLTNATPLSMCNSS 326
            .|...:.|.||..|||:.::.|||||||||::|..|.....||||...|||:.::::..::||  
Zfish   243 FYQHYQWVNNSLTEFGKEVVHEMNRLGMLVDLSHSSWETARAVLKHTAAPVIFSHSSAYAVCN-- 305

  Fly   327 NIASIPDHVLSLLPENGGVILLNLER----CGDRTLGVREAITAINYVRKVAGVDHIGLG----- 382
            |:.::||.:|.||..|||:|::||..    |......|.......:::::|.|.:.||:|     
Zfish   306 NVRNVPDDLLLLLKRNGGLIMVNLYNNFIACSSNKANVSIVADHFDHIKRVIGAESIGIGADYDG 370

  Fly   383 --GAPK------SYALLLAELARDRVWGNAAIKKLVGGNVMRILREIETLKNRL----PLYEEWI 435
              |.|:      .|..|:.||.. |.|....:..::..|.:::...:|.:::.:    |...| |
Zfish   371 AQGFPEGLEDVSKYPALIEELIA-RNWTEQELAGVLRLNFLKVFEMVEKIRDDMLDTSPSEVE-I 433

  Fly   436 PHESIESNSYCR 447
            |.  :|:|:.||
Zfish   434 PF--LEANNSCR 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5282NP_649221.1 Peptidase_M19 123..420 CDD:395996 97/304 (32%)
dpep2XP_068078794.1 Peptidase_M19 104..414 CDD:395996 97/303 (32%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.